KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043452
Entry
101043452         CDS       T04350                                 

Gene name
GNAS
Definition
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas isoform X1
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04024  cAMP signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04270  Vascular smooth muscle contraction
sbq04540  Gap junction
sbq04611  Platelet activation
sbq04713  Circadian entrainment
sbq04714  Thermogenesis
sbq04724  Glutamatergic synapse
sbq04726  Serotonergic synapse
sbq04728  Dopaminergic synapse
sbq04730  Long-term depression
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04911  Insulin secretion
sbq04912  GnRH signaling pathway
sbq04913  Ovarian steroidogenesis
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04921  Oxytocin signaling pathway
sbq04922  Glucagon signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq04924  Renin secretion
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04961  Endocrine and other factor-regulated calcium reabsorption
sbq04962  Vasopressin-regulated water reabsorption
sbq04970  Salivary secretion
sbq04971  Gastric acid secretion
sbq04972  Pancreatic secretion
sbq04976  Bile secretion
sbq05012  Parkinson disease
sbq05030  Cocaine addiction
sbq05031  Amphetamine addiction
sbq05032  Morphine addiction
sbq05034  Alcoholism
sbq05142  Chagas disease
sbq05146  Amoebiasis
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05200  Pathways in cancer
sbq05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101043452 (GNAS)
   04020 Calcium signaling pathway
    101043452 (GNAS)
   04072 Phospholipase D signaling pathway
    101043452 (GNAS)
   04024 cAMP signaling pathway
    101043452 (GNAS)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101043452 (GNAS)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101043452 (GNAS)
  09152 Endocrine system
   04911 Insulin secretion
    101043452 (GNAS)
   04922 Glucagon signaling pathway
    101043452 (GNAS)
   04923 Regulation of lipolysis in adipocytes
    101043452 (GNAS)
   04912 GnRH signaling pathway
    101043452 (GNAS)
   04913 Ovarian steroidogenesis
    101043452 (GNAS)
   04915 Estrogen signaling pathway
    101043452 (GNAS)
   04921 Oxytocin signaling pathway
    101043452 (GNAS)
   04926 Relaxin signaling pathway
    101043452 (GNAS)
   04935 Growth hormone synthesis, secretion and action
    101043452 (GNAS)
   04918 Thyroid hormone synthesis
    101043452 (GNAS)
   04928 Parathyroid hormone synthesis, secretion and action
    101043452 (GNAS)
   04916 Melanogenesis
    101043452 (GNAS)
   04924 Renin secretion
    101043452 (GNAS)
   04925 Aldosterone synthesis and secretion
    101043452 (GNAS)
   04927 Cortisol synthesis and secretion
    101043452 (GNAS)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101043452 (GNAS)
   04270 Vascular smooth muscle contraction
    101043452 (GNAS)
  09154 Digestive system
   04970 Salivary secretion
    101043452 (GNAS)
   04971 Gastric acid secretion
    101043452 (GNAS)
   04972 Pancreatic secretion
    101043452 (GNAS)
   04976 Bile secretion
    101043452 (GNAS)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101043452 (GNAS)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101043452 (GNAS)
  09156 Nervous system
   04724 Glutamatergic synapse
    101043452 (GNAS)
   04728 Dopaminergic synapse
    101043452 (GNAS)
   04726 Serotonergic synapse
    101043452 (GNAS)
   04730 Long-term depression
    101043452 (GNAS)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101043452 (GNAS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101043452 (GNAS)
   04714 Thermogenesis
    101043452 (GNAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101043452 (GNAS)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101043452 (GNAS)
  09165 Substance dependence
   05030 Cocaine addiction
    101043452 (GNAS)
   05031 Amphetamine addiction
    101043452 (GNAS)
   05032 Morphine addiction
    101043452 (GNAS)
   05034 Alcoholism
    101043452 (GNAS)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101043452 (GNAS)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101043452 (GNAS)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101043452 (GNAS)
   05165 Human papillomavirus infection
    101043452 (GNAS)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101043452 (GNAS)
   05142 Chagas disease
    101043452 (GNAS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101043452 (GNAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101043452 (GNAS)
   04031 GTP-binding proteins [BR:sbq04031]
    101043452 (GNAS)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101043452 (GNAS)
  Exosomal proteins of other body fluids (saliva and urine)
   101043452 (GNAS)
  Exosomal proteins of colorectal cancer cells
   101043452 (GNAS)
  Exosomal proteins of bladder cancer cells
   101043452 (GNAS)
GTP-binding proteins [BR:sbq04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    101043452 (GNAS)
SSDB
Motif
Pfam: G-alpha Arf Roc Gtr1_RagA GTP_EFTU bHLH-MYC_N AAA_29
Other DBs
NCBI-GeneID: 101043452
NCBI-ProteinID: XP_010341454
LinkDB
Position
Unknown
AA seq 426 aa
MQAFGGCFGRSESPQPRASRSSKVKKVPLAEKRRQMRKEALEKRAQKRAEKKRSKLIDKQ
LQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGSEK
ATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYE
HAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIF
ETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQE
ALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEP
GEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHL
RQYELL
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgcaagccttcgggggctgcttcggtcgatctgagagtccccagcccagagcttcacgc
tcctccaaggtcaagaaggtacccctggcggagaagcgccgacagatgcgcaaagaagcc
ctggagaagcgggcccagaagcgcgcagagaagaaacgcagcaagctcatcgacaagcaa
ctccaggacgaaaagatgggctacatgtgtacgcaccgcctgctgcttctaggtgctgga
gaatctggtaaaagcaccattgtgaagcagatgaggatcctgcatgttaatgggtttaat
ggagagggcggcgaagaggacccgcaggctgcaaggagcaacagcgatggcagtgagaag
gcaaccaaagtgcaggacatcaaaaacaacctgaaagaggcgatcgaaaccattgtggcc
gccatgagcaacctggtgccccctgtggagctggccaaccctgagaaccagttcagagtg
gactacattctgagtgtgatgaacgtgcctgacttcgacttccctcccgaattctacgag
catgccaaggctctgtgggaggatgaaggagtgcgtgcctgctacgaacgctccaacgag
taccagctgattgactgcgcccagtacttcctggacaagatcgatgtgatcaagcaggct
gactatgtgccgagcgaccaggacctgcttcgctgccgtgtcctgacttctggaatcttt
gagaccaagttccaggtggacaaagtcaacttccacatgtttgacgtgggtggccagcgt
gatgaacgtcgcaagtggatccagtgcttcaacgatgtgactgccatcatcttcgtggtg
gccagcagcagctacaacatggtcatccgggaggacaaccagaccaaccgcctgcaggag
gctctgaacctcttcaagagcatctggaacaacagatggctgcgtaccatctctgtgatt
ctgttcctcaacaagcaagatctgctcgctgagaaagtccttgctgggaaatcgaagatt
gaggactactttccagaatttgctcgctacactactcctgaggacgctactcccgagccc
ggagaggacccacgcgtgacccgggccaagtacttcattcgagatgagtttctgaggatc
agcactgccagtggggacggccgccactactgctaccctcacttcacctgcgctgtggac
actgagaacatccgccgtgtgttcaacgactgccgtgacatcatccagcgcatgcacctt
cgtcagtacgagctgctctaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 104652116
Entry
104652116         CDS       T04350                                 

Definition
(RefSeq) neuroendocrine secretory protein 55
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04024  cAMP signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04270  Vascular smooth muscle contraction
sbq04540  Gap junction
sbq04611  Platelet activation
sbq04713  Circadian entrainment
sbq04714  Thermogenesis
sbq04724  Glutamatergic synapse
sbq04726  Serotonergic synapse
sbq04728  Dopaminergic synapse
sbq04730  Long-term depression
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04911  Insulin secretion
sbq04912  GnRH signaling pathway
sbq04913  Ovarian steroidogenesis
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04921  Oxytocin signaling pathway
sbq04922  Glucagon signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq04924  Renin secretion
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04961  Endocrine and other factor-regulated calcium reabsorption
sbq04962  Vasopressin-regulated water reabsorption
sbq04970  Salivary secretion
sbq04971  Gastric acid secretion
sbq04972  Pancreatic secretion
sbq04976  Bile secretion
sbq05012  Parkinson disease
sbq05030  Cocaine addiction
sbq05031  Amphetamine addiction
sbq05032  Morphine addiction
sbq05034  Alcoholism
sbq05142  Chagas disease
sbq05146  Amoebiasis
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05200  Pathways in cancer
sbq05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104652116
   04020 Calcium signaling pathway
    104652116
   04072 Phospholipase D signaling pathway
    104652116
   04024 cAMP signaling pathway
    104652116
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104652116
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104652116
  09152 Endocrine system
   04911 Insulin secretion
    104652116
   04922 Glucagon signaling pathway
    104652116
   04923 Regulation of lipolysis in adipocytes
    104652116
   04912 GnRH signaling pathway
    104652116
   04913 Ovarian steroidogenesis
    104652116
   04915 Estrogen signaling pathway
    104652116
   04921 Oxytocin signaling pathway
    104652116
   04926 Relaxin signaling pathway
    104652116
   04935 Growth hormone synthesis, secretion and action
    104652116
   04918 Thyroid hormone synthesis
    104652116
   04928 Parathyroid hormone synthesis, secretion and action
    104652116
   04916 Melanogenesis
    104652116
   04924 Renin secretion
    104652116
   04925 Aldosterone synthesis and secretion
    104652116
   04927 Cortisol synthesis and secretion
    104652116
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104652116
   04270 Vascular smooth muscle contraction
    104652116
  09154 Digestive system
   04970 Salivary secretion
    104652116
   04971 Gastric acid secretion
    104652116
   04972 Pancreatic secretion
    104652116
   04976 Bile secretion
    104652116
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    104652116
   04961 Endocrine and other factor-regulated calcium reabsorption
    104652116
  09156 Nervous system
   04724 Glutamatergic synapse
    104652116
   04728 Dopaminergic synapse
    104652116
   04726 Serotonergic synapse
    104652116
   04730 Long-term depression
    104652116
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104652116
  09159 Environmental adaptation
   04713 Circadian entrainment
    104652116
   04714 Thermogenesis
    104652116
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104652116
  09164 Neurodegenerative disease
   05012 Parkinson disease
    104652116
  09165 Substance dependence
   05030 Cocaine addiction
    104652116
   05031 Amphetamine addiction
    104652116
   05032 Morphine addiction
    104652116
   05034 Alcoholism
    104652116
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104652116
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104652116
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104652116
   05165 Human papillomavirus infection
    104652116
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104652116
   05142 Chagas disease
    104652116
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104652116
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    104652116
   04031 GTP-binding proteins [BR:sbq04031]
    104652116
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104652116
  Exosomal proteins of other body fluids (saliva and urine)
   104652116
  Exosomal proteins of colorectal cancer cells
   104652116
  Exosomal proteins of bladder cancer cells
   104652116
GTP-binding proteins [BR:sbq04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    104652116
SSDB
Motif
Pfam: NESP55
Other DBs
NCBI-GeneID: 104652116
NCBI-ProteinID: XP_010341460
LinkDB
Position
Unknown
AA seq 252 aa
MDRRSRAQQWRRARQNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQ
RRSFLNAHHRSGAQVFPESPESESDHEHEEADLELSLPECLEYEEEFDYETESETESEIE
SETDFETEPETAPATEPETEPEDERGPVVPKRSTFGQSLVESQSLTQRLHALKLRSPDAS
PSRAPPSTQEPQSPREEQELKPEDKDPRDPEESEEPKEKKQRRRCKPKKKPTRREASPES
PSKKGPIPIRRH
NT seq 759 nt   +upstreamnt  +downstreamnt
atggatcgcaggtcccgggctcagcagtggcgccgagctcgccaaaattacaacgacctg
tgcccgcccataggccgccgggcagccaccgcgctcctctggctctcctgctccatcgcg
ctcctccgcgcccttgccacctccaacgcccgtgcccagcagcgcgcagctgcccaacag
cgccggagcttccttaacgcccaccaccgctccggcgcccaggtattccctgagtccccc
gaatcggaatctgaccacgagcacgaggaggcagaccttgagctgtcccttcccgagtgc
ctagagtacgaggaagagttcgactacgagaccgagagcgagaccgaatccgaaatcgag
tctgagaccgacttcgagaccgagcctgagaccgcccctgccactgagcctgagactgag
ccggaagacgagcgcggccccgtggtgcccaagcgctccaccttcggccagtccctcgtg
gagagccagtctctcacccagcgcctgcacgccctcaagttgcgaagccccgacgcctcc
ccgagtcgcgcgccgcccagcactcaggagccccagagccccagggaggagcaggagctc
aagcccgaggacaaggatccgagggaccccgaagagtctgaggagcccaaggagaagaag
cagcggcgtcgctgcaagccgaagaagaagcccacccgccgtgaggcgtccccggagtcc
ccttccaaaaagggacccatccccatccggcgtcactaa

DBGET integrated database retrieval system