KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043458Help
Entry
101043458         CDS       T04350                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle protein 23 homolog
  KO
K03355  anaphase-promoting complex subunit 8
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04110  Cell cycle
sbq04114  Oocyte meiosis
sbq04120  Ubiquitin mediated proteolysis
sbq04914  Progesterone-mediated oocyte maturation
sbq05166  HTLV-I infection
Module
sbq_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101043458 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101043458 (CDC23)
   04114 Oocyte meiosis
    101043458 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101043458 (CDC23)
 09160 Human Diseases
  09167 Infectious diseases
   05166 HTLV-I infection
    101043458 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101043458 (CDC23)
   03036 Chromosome and associated proteins [BR:sbq03036]
    101043458 (CDC23)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     101043458 (CDC23)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    101043458 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_7 ANAPC3 TPR_16 TPR_17 TPR_12 TPR_9 DUF772 TPR_15
Motif
Other DBs
NCBI-GeneID: 101043458
NCBI-ProteinID: XP_003933997
UniProt: A0A2K6RZC4
LinkDB All DBs
Position
Unknown
AA seq 597 aa AA seqDB search
MAAGASMVQVAVTAAVAPVLSTNSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLAELQPPPPVTEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETSTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgggtgcctccatggtccaggtggctgtgacggcagcagtggcacctgtcctg
tccacgaacagcgatttctcagatttgcgggaaattaaaaagcaactgctgcttattgcg
ggtctgactcgggagcggggcctactgcacagtagcaaatggtcggcggagttggccttc
tctctccccgcattgccactggccgagctgcaaccgcctccgcctgttacagaggaggat
gctcaggatatggatgcctataccctggccaaggcctactttgacgttaaagagtatgat
cgggcagcacatttcctgcatggctgcaatagcaagaaagcctattttctgtatatgtat
tcccgatatctgtctggagaaaaaaagaaggacgatgaaacagttgatagcttaggtccc
ttggaaaaaggacaagtgaaaaatgaagctcttagagaattgagagtggagctcagcaaa
aaacaccaagctcgggaacttgatggatttggactttatctgtatggtgtggtgcttcga
aaactggacttggtgaaagaggccattgatgtgtttgtggaggctactcatgttttgccc
ttgcactggggagcctggttagaactctgtaacctgatcacagacaaagagatgctgaag
ttcctgtctttgccagacacctggatgaaagagttttttctggctcatatatacacagag
ttgcagttgatagaggaggccctgcaaaagtatcagaatctcattgatgtgggcttctct
aagagctcatatattgtttcccaaattgcagttgcctatcacaatatcagagatattgac
aaagccctctccatttttaatgagctaaggaaacaagacccttacaggattgaaaatatg
gacacattctccaaccttctttatgtcaggagcatgaaatcggagttgagttatctggct
cataacctctgtgagattgataaatatcgtgtagaaacatgctgtgtaattggcaattat
tacagtttacgttctcagcatgagaaagcagccttatatttccagagagccctgaaatta
aatcctcggtatctgggtgcctggacactgatgggacatgagtacatggagatgaagaac
acatctgctgctatccaggcttatagacatgccattgaagtcaacaagcgggactacaga
gcttggtatggccttgggcagacctatgaaatccttaagatgccattttactgcctttat
tattatagacgagcccaccagcttcgacccaatgattctcgcatgctggttgctttagga
gagtgttacgagaaactcaatcaactagtggaagccaaaaagtgttattggagagcttac
gccgtgggagatgtggagaaaatggctctggtgaaactggcaaagcttcatgaacagttg
actgagtcagaacaggctgcccagtgttacatcaaatatatccaagatatctattcctgt
ggggaaatagtagaacacttggaggaaagcactgctttccgctatctggcccagtactat
tttaagtgcaaactgtgggatgaagcttcaacttgtgcacaaaagtgttgtgccttcaat
gatacccgagaagaaggtaaggccttactccggcaaatcctacagcttcggaaccaaggc
gagacttccaccactgaggtgcctgctccttttttcctgcctgcttcactgtctgctaat
aacacccccacacgcagagtttctccactcaacttgtcttctgtcacaccatag

DBGET integrated database retrieval system