KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043528
Entry
101043528         CDS       T04350                                 

Gene name
BCL2L11
Definition
(RefSeq) bcl-2-like protein 11 isoform X1
  KO
K16341  Bcl-2-like protein 11
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq04068  FoxO signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04215  Apoptosis - multiple species
sbq04932  Non-alcoholic fatty liver disease
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101043528 (BCL2L11)
   04151 PI3K-Akt signaling pathway
    101043528 (BCL2L11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101043528 (BCL2L11)
   04215 Apoptosis - multiple species
    101043528 (BCL2L11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101043528 (BCL2L11)
   05206 MicroRNAs in cancer
    101043528 (BCL2L11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101043528 (BCL2L11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101043528 (BCL2L11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101043528 (BCL2L11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101043528 (BCL2L11)
SSDB
Motif
Pfam: Bclx_interact Bim_N PMAIP1
Other DBs
NCBI-GeneID: 101043528
NCBI-ProteinID: XP_010335743
UniProt: A0A2K6TRP9
LinkDB
Position
Unknown
AA seq 200 aa
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSP
QGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPP
CQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDH
PHMVILRLLRYIVRLVWRMH
NT seq 603 nt   +upstreamnt  +downstreamnt
atggcaaagcaaccttccgatgtaagttctgagtgtgaccgagaaggtagacagttgcag
cctgcggagagacctccccagctcagacctggggcccctacctccctacagacagagcca
caaggtaatcccgaaggcaatcacggaggtgaaggggacagctgcccccacggcagccct
cagggcccgctggccccaccggccagccctggcccttttgctaccagatccccgcttttc
atctttgtgagaagatcctccgtgctgtctcgatcctccagtgggtatttctcttttgac
acagacaggagcccagcacccatgagttgtgacaaatcaacacaaaccccaagtcctcct
tgccaggccttcaaccactatctcagtgcaatggcttccatgaggcaatctcaggctgaa
cctgcaggtatgcgcccggagatatggatcgcccaagagttgcggcgtatcggagacgag
tttaacgcttattatccaaggagggtatttttgaataattaccaagcagccgaagaccac
ccgcacatggttatcttacgactgttacgttacattgtccgcctggtgtggagaatgcat
tga

DBGET integrated database retrieval system