KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043581
Entry
101043581         CDS       T04350                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor isoform X2
  KO
K05771  glucocorticoid receptor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101043581 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101043581 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:sbq03310]
    101043581 (NR3C1)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    101043581 (NR3C1)
Nuclear receptors [BR:sbq03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   101043581 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 101043581
NCBI-ProteinID: XP_003920603
UniProt: O13186
LinkDB
Position
Unknown
AA seq 777 aa
MDSKESLTPGKEENPSSVLTQERGNVMDFCKILRGGATLKVSVSSTSLAAASQSDSKQQR
LLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLQ
LLEESIANLNRSTSVPENPKSSASSSVSAAPKEKEFPKTHSDVSSEQQNLKGQTGSNGGN
VKLYTADQSTFDILQDLEFSSGSPGKETNQSPWKSDLLIDENCLLSPLAGEEDSFLLEGN
SNEDCKPLILPDTKPKIKDNGDLVLSSSSNVTLPQVKTEKEDFIELCTPGVIKQEKLSTV
YCQASFPGANIIGNKMSAISIHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG
SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRK
CLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPANKTIVPATLPQLTPTLVSLLEVIE
PEVLYAGYDSTVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW
MFLMAFALGWRSYRQASSNLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSY
EEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK
LLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQLPKYSNGNIKKLLFHQK
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggactccaaagaatcattaactcctggtaaagaagaaaatccgagtagtgtgcttact
caggagaggggaaatgtgatggacttctgtaaaatcctaaggggaggagctactctgaag
gtttctgtatcttcaacctcactggctgctgcatctcagtcagactccaagcagcaaaga
cttttggttgattttccgaaaggctcagtaagcaatgcgcaacagccagatctgtccaaa
gcagtttcactctcgatgggactctatatgggagaaacagaaacaaaagtaatgggaaat
gacctgggattcccacagcagggccaaatcagcctctcctcaggggaaacagacttacag
cttctggaagaaagcattgcaaacctcaataggtcgaccagtgttccagagaaccccaag
agttcagcatcctcttccgtgtctgctgcccccaaagagaaggagtttccaaaaactcat
tctgatgtgtcttcagaacagcaaaatttgaagggccagactggctccaacggtggcaat
gtgaaattgtataccgcagaccaaagcacctttgacattttgcaggatttggagttttct
tctgggtccccaggtaaagagacgaatcagagtccttggaaatcagacctgttgatagat
gaaaactgtttgctttctcctctggcgggagaagaggattcattccttttggaaggaaac
tcgaatgaggactgcaagcctctcattttaccggacactaaacctaaaattaaggataat
ggagatctggttttgtcaagctccagtaatgtaacactgccccaagtgaaaacagaaaaa
gaagatttcatcgaactctgtacccctggggtaattaagcaagagaaactgagcacagtt
tactgtcaggcaagctttcctggagcaaatataattggtaataaaatgtctgccatttct
attcatggtgtgagtacctctggaggacagatgtaccactatgacatgaatacagcatcc
ctttctcaacagcaggatcagaagcctatttttaatgtcattccaccaattcctgttggt
tccgaaaattggaataggtgccaagggtctggagacgacaacttgacttccttggggact
ctgaacttccctggtcgaacagttttttctaatggctattcaagccccagcatgagacca
gatgtaagctctcctccatctagctcctcaacagcaacaacgggaccacctcccaaactc
tgcctggtgtgctctgatgaagcttcaggatgccattatggagtcttaacttgtggaagc
tgtaaagttttcttcaaaagagcagtggaaggacagcacaattatttgtgtgctggaagg
aatgattgcatcatcgataaaattcgaagaaaaaactgcccagcatgccgctaccgaaaa
tgtcttcaagctggaatgaacctggaagctcgaaaaacaaagaaaaaaataaaaggaatt
cagcaggccactacaggagtctcacaagaaacctctgaaaatcctgctaacaaaacaata
gttcctgcaacgttaccacaactcacccctaccctggtgtcactgttggaggtcattgaa
cctgaggtgttgtatgccggttatgatagcactgttccagactcaacctggaggatcatg
accacgctcaacatgttaggagggcggcaagttattgcagccgtgaagtgggcaaaggcg
ataccaggtttcaggaacttacacctggatgaccaaatgaccctactgcaatactcctgg
atgtttcttatggcatttgccttggggtggagatcatatagacaagcaagttcaaaccta
ctgtgttttgctcctgatctgattattaatgagcagagaatgactctaccctgcatgtac
gaccaatgtaaacatatgctgtatgtttcctctgagttacacaggcttcaggtatcttat
gaagagtatctctgtatgaaaaccttactgcttctctcttcagttcctaaggatggtttg
aagagccaagagctatttgatgaaattagaatgacctacatcaaagagctcggaaaagcc
attgtcaagagggaagggaactccagccagaactggcagcggttttatcaactgacaaaa
ctcttggattctatgcatgaagtggttgaaaatctccttaactattgcttccaaacattt
ttggataagaccatgagtattgaattcccagagatgttagctgaaatcatcaccaatcag
ctaccaaaatattcaaatggaaatatcaaaaaacttctgtttcatcaaaagtga

DBGET integrated database retrieval system