KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043591
Entry
101043591         CDS       T04350                                 

Gene name
CD36
Definition
(RefSeq) platelet glycoprotein 4
  KO
K06259  CD36 antigen
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04145  Phagosome
sbq04152  AMPK signaling pathway
sbq04512  ECM-receptor interaction
sbq04640  Hematopoietic cell lineage
sbq04920  Adipocytokine signaling pathway
sbq04931  Insulin resistance
sbq04975  Fat digestion and absorption
sbq04979  Cholesterol metabolism
sbq05144  Malaria
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101043591 (CD36)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101043591 (CD36)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101043591 (CD36)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101043591 (CD36)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101043591 (CD36)
   03320 PPAR signaling pathway
    101043591 (CD36)
  09154 Digestive system
   04975 Fat digestion and absorption
    101043591 (CD36)
   04979 Cholesterol metabolism
    101043591 (CD36)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101043591 (CD36)
  09174 Infectious disease: parasitic
   05144 Malaria
    101043591 (CD36)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101043591 (CD36)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101043591 (CD36)
   04090 CD molecules [BR:sbq04090]
    101043591 (CD36)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    101043591 (CD36)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   101043591 (CD36)
CD molecules [BR:sbq04090]
 Proteins
  101043591 (CD36)
SSDB
Motif
Pfam: CD36
Other DBs
NCBI-GeneID: 101043591
NCBI-ProteinID: XP_010343090
UniProt: A0A2K6SF08
LinkDB
Position
Unknown
AA seq 472 aa
MGCDRNCGLITGAVVGAVLAVLGGILMPVGDLLIEKTIKKEVVLEEGTIAFKNWVKTGTE
VYRQFWVFDVQNPQEVMMNSSNIKVEQKGPYTYRVRYLAKENVTQDPENNTVSFLQPNGA
IFEPSLSVGTENDNFTVLNLAVAAAAHIYQNAFVQVVLNSLIKKSKSSMFQTRSLKELLW
GYKDPFLSLVPYPVSTTVGLFYPYNNTADGVYKVFNGKDDISKVAIIDTYKGKRNLSYWE
SYCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAIFESEINLKGIPVYRFVLPSKAF
ASPLENPDNHCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLHSSPDVSEPIDGL
NPNEEEHRTYLDIEPITGFTLRFAKRLQVNLLVKPSIKIEALKRLKRNYIVPIIWLNETG
TIGNEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKAIK
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgggctgtgatcggaactgtgggctcatcactggggctgtcgttggtgccgtcctggct
gtgttaggaggtattctaatgccagttggagacttgctcattgagaagacaattaaaaag
gaagttgtccttgaagaaggtacaattgcttttaaaaattgggttaaaacaggcacagaa
gtttacagacagttttgggtctttgatgtgcaaaatccacaggaagtgatgatgaacagc
agcaacattaaagttgagcaaaaaggtccttatacatacagagttcgttatctagccaag
gaaaatgtaacccaggaccccgagaacaacacagtctctttcctgcagcccaatggtgcc
atctttgagccttcactatcagttggaacagaaaacgacaacttcacggttctcaatctg
gctgtggcagctgcagcccatatctatcaaaatgcatttgttcaagtggtactcaattca
cttattaagaagtcaaaatcttccatgttccaaaccagaagtttgaaagaactgttatgg
ggctataaggatccgtttttgagtttggttccataccctgttagtaccacagttggtcta
ttttatccttacaacaatactgcggatggagtttacaaagttttcaatggaaaagatgac
ataagcaaagttgccataattgacacttataaaggtaaaaggaatctctcctattgggaa
agttattgtgacatgattaatggtacagatgcagcctcgtttccaccttttgttgagaag
agccaggttttgcagttcttttcttctgacatttgcaggtcaatctatgctatatttgaa
tccgaaattaatctgaaaggaatccctgtgtacagatttgttcttccatccaaagccttt
gcctctccacttgaaaacccagacaaccattgtttctgcacagaaaaaattatctcaaaa
aattgtacatcgtatggtgtgctagacatcagcaaatgcaaagaagggagacctgtgtac
atttcacttcctcattttctacattcaagtcctgatgtttcagaacctattgatggctta
aacccaaatgaagaagaacataggacatacttggatattgaacctataactggattcact
ttacgatttgccaaacgactgcaggtgaacctgttggtcaagccgtcaataaaaattgaa
gcattaaagcgtttgaagaggaactatattgtgcctattatttggcttaatgagactggg
accattggtaatgagaaggcaaacatgttcagaagtcaagttactggaaaaataaacctc
cttggcctgatagaaatgatcttacttagtgttggtgtggtgatgtttgttgctttcatg
atttcgtattgtgcatgcagatcaaaagcaataaaataa

DBGET integrated database retrieval system