KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043605
Entry
101043605         CDS       T04350                                 

Gene name
ARAF
Definition
(RefSeq) serine/threonine-protein kinase A-Raf
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04068  FoxO signaling pathway
sbq04270  Vascular smooth muscle contraction
sbq04650  Natural killer cell mediated cytotoxicity
sbq04720  Long-term potentiation
sbq04726  Serotonergic synapse
sbq04730  Long-term depression
sbq04810  Regulation of actin cytoskeleton
sbq04910  Insulin signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05034  Alcoholism
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101043605 (ARAF)
   04012 ErbB signaling pathway
    101043605 (ARAF)
   04068 FoxO signaling pathway
    101043605 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101043605 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101043605 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101043605 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    101043605 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    101043605 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101043605 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    101043605 (ARAF)
   04720 Long-term potentiation
    101043605 (ARAF)
   04730 Long-term depression
    101043605 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101043605 (ARAF)
   05205 Proteoglycans in cancer
    101043605 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101043605 (ARAF)
   05212 Pancreatic cancer
    101043605 (ARAF)
   05225 Hepatocellular carcinoma
    101043605 (ARAF)
   05226 Gastric cancer
    101043605 (ARAF)
   05214 Glioma
    101043605 (ARAF)
   05221 Acute myeloid leukemia
    101043605 (ARAF)
   05220 Chronic myeloid leukemia
    101043605 (ARAF)
   05218 Melanoma
    101043605 (ARAF)
   05211 Renal cell carcinoma
    101043605 (ARAF)
   05219 Bladder cancer
    101043605 (ARAF)
   05215 Prostate cancer
    101043605 (ARAF)
   05213 Endometrial cancer
    101043605 (ARAF)
   05224 Breast cancer
    101043605 (ARAF)
   05223 Non-small cell lung cancer
    101043605 (ARAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101043605 (ARAF)
   05022 Pathways of neurodegeneration - multiple diseases
    101043605 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    101043605 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101043605 (ARAF)
   05160 Hepatitis C
    101043605 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101043605 (ARAF)
   01522 Endocrine resistance
    101043605 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101043605 (ARAF)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101043605 (ARAF)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101043605 (ARAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like Pkinase_fungal APH TUG-UBL1 zf-RING-like Kdo
Other DBs
NCBI-GeneID: 101043605
NCBI-ProteinID: XP_010348470
UniProt: A0A2K6SB81
LinkDB
Position
Unknown
AA seq 606 aa
MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTTCQQFYHSVQDLSRGSKQQEAPSNRPLNESL
TPQGPSPCTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSSTAPMDSNLIQLTGQSFS
TDAAGSRGGGDGAPRGSPSPLSLSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSG
YYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVSQPTAEQAQAFKNEMQVLRK
TRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYL
HAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRM
QDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSNCPK
AMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLS
AARLVP
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggagccaccacggggcccccctgccaatggggccgagccgtcccgggcagtgggcacc
gtcaaagtgtacctgcccaacaagcaacgcacggtggtaactgtccgggatggcatgagt
gtctacgactctctagacaaggccctgaaggtgcggggtctaaatcaggactgctgtgtg
gtctaccgactcatcaagggacgaaagacggttactgcctgggacacggccatcgctccc
ctggatggcgaggagctcattgtcgaggtccttgaagatgttccgctgaccatgcacaat
tttgtacggaagaccttcttcagcctggcgttctgcgacttctgccttaagtttctgttc
catggcttccgttgccaaacctgtggctacaagttccaccagcattgttcctccaaagtc
cccacagtctgtgttgacatgagtaccacctgccaacagttctaccacagtgtccaggat
ttgtccagaggctccaaacagcaggaggctccctcaaaccgccccctgaatgagtcgcta
accccccagggtcccagcccctgcacccagcactgtgacccggagcacttccccttcccc
gctccagccaatgctcccctgcagcgcatccgctccacgtccactcccaacgtccatatg
gtcagctccacagcccccatggactccaacctcatccagctcactggccagagtttcagc
actgacgctgccggtagtagaggaggtggagatggagccccccggggaagccccagccca
ctcagcctgtcctcggggaggaagtccccacattccaagtcaccagcagagcagcgtgag
cggaagtccttggctgatgacaagaagaaagtgaagaacctggggtaccgggactcaggc
tattactgggaggtaccacccagtgaggtgcagctgctgaagaggatcgggacaggctcg
tttggcaccgtgtttcgagggcggtggcatggcgatgtggctgtgaaggtgctcaaggtg
tcccagcccacagctgagcaggcccaagccttcaagaacgagatgcaggtgctcaggaag
acgagacatgtcaacattttgctgttcatgggcttcatgacccggccgggatttgccatc
atcacacagtggtgtgagggctccagcctctaccaccacctgcatgtggccgacacacgc
ttcgacatggtccagctcatcgatgtggcccggcagactgcccagggcatggactacctc
catgccaagaacatcatccaccgagatctcaagtctaacaacatcttcctacacgagggg
ctcacggtgaagattggtgactttggcttggccacggtgaagactcgatggagtggggcc
cagcccttggagcagccctcaggttctgtgctgtggatggcagctgaggtgatccgtatg
caggacccgaacccctacagcttccagtcagatgtctatgcctacggggttgtgctctac
gagctcatgactggctcactgccttacagccacattggctgccgtgaccagattatcttt
atggtgggccgtggctatctgtccccggacctcagcaaaatctccagcaactgccccaag
gccatgcggcgcctgctgtctgactgcctcaagttccagcgggaggagcggcccctattc
ccccagattttggccacaattgagctgctgcagcggtcactccccaagatcgagcggagt
gcctcggaaccctccttgcaccgcacccaggctgatgagttgcctgcctgcctactcagc
gcagcccgccttgtgccttag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052142
Entry
101052142         CDS       T04350                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X2
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04015  Rap1 signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04068  FoxO signaling pathway
sbq04150  mTOR signaling pathway
sbq04270  Vascular smooth muscle contraction
sbq04510  Focal adhesion
sbq04650  Natural killer cell mediated cytotoxicity
sbq04720  Long-term potentiation
sbq04722  Neurotrophin signaling pathway
sbq04726  Serotonergic synapse
sbq04730  Long-term depression
sbq04810  Regulation of actin cytoskeleton
sbq04910  Insulin signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04934  Cushing syndrome
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05034  Alcoholism
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05216  Thyroid cancer
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101052142 (BRAF)
   04012 ErbB signaling pathway
    101052142 (BRAF)
   04015 Rap1 signaling pathway
    101052142 (BRAF)
   04068 FoxO signaling pathway
    101052142 (BRAF)
   04024 cAMP signaling pathway
    101052142 (BRAF)
   04150 mTOR signaling pathway
    101052142 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101052142 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101052142 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101052142 (BRAF)
   04062 Chemokine signaling pathway
    101052142 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101052142 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    101052142 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    101052142 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101052142 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    101052142 (BRAF)
   04720 Long-term potentiation
    101052142 (BRAF)
   04730 Long-term depression
    101052142 (BRAF)
   04722 Neurotrophin signaling pathway
    101052142 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101052142 (BRAF)
   05205 Proteoglycans in cancer
    101052142 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101052142 (BRAF)
   05212 Pancreatic cancer
    101052142 (BRAF)
   05225 Hepatocellular carcinoma
    101052142 (BRAF)
   05226 Gastric cancer
    101052142 (BRAF)
   05214 Glioma
    101052142 (BRAF)
   05216 Thyroid cancer
    101052142 (BRAF)
   05221 Acute myeloid leukemia
    101052142 (BRAF)
   05220 Chronic myeloid leukemia
    101052142 (BRAF)
   05218 Melanoma
    101052142 (BRAF)
   05211 Renal cell carcinoma
    101052142 (BRAF)
   05219 Bladder cancer
    101052142 (BRAF)
   05215 Prostate cancer
    101052142 (BRAF)
   05213 Endometrial cancer
    101052142 (BRAF)
   05224 Breast cancer
    101052142 (BRAF)
   05223 Non-small cell lung cancer
    101052142 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101052142 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    101052142 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    101052142 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101052142 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101052142 (BRAF)
   05160 Hepatitis C
    101052142 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101052142 (BRAF)
   01522 Endocrine resistance
    101052142 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101052142 (BRAF)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101052142 (BRAF)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101052142 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 101052142
NCBI-ProteinID: XP_003929813
LinkDB
Position
Unknown
AA seq 764 aa
MAALSGGGGGGAEPGQALFNGDMEPEAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIE
ALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASMDTVTS
SSSSSLSVLPSSLSVFQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLK
KALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTF
FTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQ
EEPSLAETALTSGSSPSAPPSDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDR
SSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGP
QRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAV
KMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLH
IIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKS
RWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNR
DQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
KIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH
NT seq 2295 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggtggcggtggcggcggcgcggagccgggccaggctctgttcaac
ggggacatggagcccgaggccggcgccggcgccgcggcctcttcggctgcggaccctgcc
attcctgaggaggtgtggaatatcaaacaaatgattaagttgacacaggaacatatagag
gccctattggacaaatttggtggggagcataatccaccatcaatatatctggaggcatat
gaagaatacaccagcaagctagatgcactccaacaaagagaacaacagttattggaatct
ctggggaacggaactgatttttctgtttctagctctgcatcaatggacaccgttacatct
tcttcctcttctagcctttcagtgctaccttcatctctttcagtttttcaaaatcccaca
gatgtggcacggagcaaccccaagtcaccacaaaaacctatcgttagagtattcctgccc
aacaaacagaggacagtggtacctgcaaggtgtggcgttacagtccgagacagtctaaag
aaagcactgatgatgagaggtctaatcccagagtgctgtgctgtttacagaattcaggat
ggagagaagaaaccaattggctgggacactgatatttcctggcttactggagaagaattg
catgtggaagtgttggagaatgttccacttacaacacacaactttgtacgaaaaacattt
ttcaccttagcattttgtgacttttgtcgaaagctgcttttccagggtttccgctgtcaa
acgtgtggttataaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaat
tatgaccaacttgatttgctgtttgtctccaagttctttgaacaccaccctataccacag
gaagagccttccttagcagagactgctcttacatctggatcatccccttccgcacccccc
tcagactctattgggccccaaattctcaccagtccatctccttcaaaatccattccaatt
ccacagcccttccgaccagcagatgaagatcatcgaaatcaatttgggcaacgagaccgg
tcctcatcagctcccaatgtgcatataaacacaatagaacctgtcaatattgatgacttg
attagagaccaaggatttcgtggtgatggaggatcaaccacaggtttgtctgccacacct
cctgcctcattacctggctcactcactaacgtgaaagccttacagaaatctccaggacct
cagcgagaaaggaagtcatcttcatcctccgaagataggaatcgaatgaaaacacttggt
agacgggactcaagtgatgattgggaaattcctgatgggcagattacagtgggacaaaga
attggatctggatcatttggaacagtctacaagggaaagtggcatggtgatgtggcagtc
aaaatgttgaatgtgacagcacccacacctcagcagttacaagccttcaaaaatgaagta
ggagtactcaggaaaacacgacacgtgaatatccttctcttcatgggctattccacaaag
ccacagctggctattgttacccagtggtgtgaaggctccagcttgtatcaccatctccat
atcattgagaccaaatttgagatgatcaaacttatagatattgcacgacagactgcacag
ggcatggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatata
tttcttcatgaagacctcacagtaaaaataggtgattttggtctagccacagtgaaatct
cgatggagtgggtcccatcagtttgaacagttgtctggatccattttgtggatggcacca
gaagtcatcagaatgcaagataaaaatccatacagctttcagtcagatgtatacgcattt
gggattgttctgtatgaattgatgactggacagttaccttattcaaacatcaacaacagg
gaccagataatttttatggtgggacgaggatacctatctccagatctcagtaaggtacgg
agtaactgtccaaaagccatgaagagattaatggcagagtgcctcaaaaagaaaagagat
gagagaccactctttccacaaattcttgcctctattgagctgctggcccgctcattgcca
aaaattcaccgcagtgcatcagaaccctccttgaatcgggctggtttccaaacagaggat
tttagtctatatgcttgtgcttctccaaaaacacccatccaggcagggggatatggtgcg
tttcctgtccactga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101054052
Entry
101054052         CDS       T04350                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X2
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04068  FoxO signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04140  Autophagy - animal
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04218  Cellular senescence
sbq04270  Vascular smooth muscle contraction
sbq04360  Axon guidance
sbq04370  VEGF signaling pathway
sbq04371  Apelin signaling pathway
sbq04510  Focal adhesion
sbq04540  Gap junction
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04613  Neutrophil extracellular trap formation
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04720  Long-term potentiation
sbq04722  Neurotrophin signaling pathway
sbq04726  Serotonergic synapse
sbq04730  Long-term depression
sbq04810  Regulation of actin cytoskeleton
sbq04910  Insulin signaling pathway
sbq04912  GnRH signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04917  Prolactin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04929  GnRH secretion
sbq04935  Growth hormone synthesis, secretion and action
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05034  Alcoholism
sbq05132  Salmonella infection
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101054052 (RAF1)
   04012 ErbB signaling pathway
    101054052 (RAF1)
   04014 Ras signaling pathway
    101054052 (RAF1)
   04015 Rap1 signaling pathway
    101054052 (RAF1)
   04370 VEGF signaling pathway
    101054052 (RAF1)
   04371 Apelin signaling pathway
    101054052 (RAF1)
   04630 JAK-STAT signaling pathway
    101054052 (RAF1)
   04068 FoxO signaling pathway
    101054052 (RAF1)
   04072 Phospholipase D signaling pathway
    101054052 (RAF1)
   04071 Sphingolipid signaling pathway
    101054052 (RAF1)
   04024 cAMP signaling pathway
    101054052 (RAF1)
   04022 cGMP-PKG signaling pathway
    101054052 (RAF1)
   04151 PI3K-Akt signaling pathway
    101054052 (RAF1)
   04150 mTOR signaling pathway
    101054052 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101054052 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    101054052 (RAF1)
   04218 Cellular senescence
    101054052 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101054052 (RAF1)
   04540 Gap junction
    101054052 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101054052 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101054052 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101054052 (RAF1)
   04625 C-type lectin receptor signaling pathway
    101054052 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    101054052 (RAF1)
   04660 T cell receptor signaling pathway
    101054052 (RAF1)
   04662 B cell receptor signaling pathway
    101054052 (RAF1)
   04664 Fc epsilon RI signaling pathway
    101054052 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    101054052 (RAF1)
   04062 Chemokine signaling pathway
    101054052 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101054052 (RAF1)
   04929 GnRH secretion
    101054052 (RAF1)
   04912 GnRH signaling pathway
    101054052 (RAF1)
   04915 Estrogen signaling pathway
    101054052 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    101054052 (RAF1)
   04917 Prolactin signaling pathway
    101054052 (RAF1)
   04921 Oxytocin signaling pathway
    101054052 (RAF1)
   04926 Relaxin signaling pathway
    101054052 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    101054052 (RAF1)
   04919 Thyroid hormone signaling pathway
    101054052 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    101054052 (RAF1)
   04916 Melanogenesis
    101054052 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101054052 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    101054052 (RAF1)
   04720 Long-term potentiation
    101054052 (RAF1)
   04730 Long-term depression
    101054052 (RAF1)
   04722 Neurotrophin signaling pathway
    101054052 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    101054052 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101054052 (RAF1)
   05206 MicroRNAs in cancer
    101054052 (RAF1)
   05205 Proteoglycans in cancer
    101054052 (RAF1)
   05230 Central carbon metabolism in cancer
    101054052 (RAF1)
   05231 Choline metabolism in cancer
    101054052 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101054052 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101054052 (RAF1)
   05212 Pancreatic cancer
    101054052 (RAF1)
   05225 Hepatocellular carcinoma
    101054052 (RAF1)
   05226 Gastric cancer
    101054052 (RAF1)
   05214 Glioma
    101054052 (RAF1)
   05221 Acute myeloid leukemia
    101054052 (RAF1)
   05220 Chronic myeloid leukemia
    101054052 (RAF1)
   05218 Melanoma
    101054052 (RAF1)
   05211 Renal cell carcinoma
    101054052 (RAF1)
   05219 Bladder cancer
    101054052 (RAF1)
   05215 Prostate cancer
    101054052 (RAF1)
   05213 Endometrial cancer
    101054052 (RAF1)
   05224 Breast cancer
    101054052 (RAF1)
   05223 Non-small cell lung cancer
    101054052 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101054052 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    101054052 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    101054052 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101054052 (RAF1)
   05152 Tuberculosis
    101054052 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101054052 (RAF1)
   05161 Hepatitis B
    101054052 (RAF1)
   05160 Hepatitis C
    101054052 (RAF1)
   05164 Influenza A
    101054052 (RAF1)
   05163 Human cytomegalovirus infection
    101054052 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101054052 (RAF1)
   05165 Human papillomavirus infection
    101054052 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101054052 (RAF1)
   01522 Endocrine resistance
    101054052 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101054052 (RAF1)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101054052 (RAF1)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101054052 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 101054052
NCBI-ProteinID: XP_003927092
UniProt: A0A2K6S6V4
LinkDB
Position
Unknown
AA seq 648 aa
MEHIQGAWKTISNGFGLKDAVFDGSSCISPTLVQQFGYQRRASDDGKLTDPSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLQEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVTRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPLPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggagcttggaagacgatcagcaatggttttggactcaaagatgct
gtgtttgatggctccagctgcatctctcctacactagttcagcagtttggctatcagcgc
cgggcatcagatgatggcaaactcacagatccttcgaagacaagcaacactatccgtgtt
ttcttgccgaacaagcaaagaacagtggtcaatgtgagaaatggaatgagcttgcatgac
tgccttatgaaagcgctgaaggtgaggggcctgcaaccagagtgctgtgcagtgttcaga
cttctccaagaacataaaggtaaaaaagcacgcttagattggaatactgatgctgcctct
ttgattggagaagaacttcaagtagatttcctggatcatgttcccctcacaacacacaac
tttgctcggaagacgttcctgaagcttgccttctgtgacatctgtcagaaattcctgctc
aatggatttcgatgtcagacttgtggctacaaatttcatgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacaactcttattgtttccaaattccact
attggtgatagtggagtcccagcactaccttctttgactatgcgtcgtatgcgagagtct
gttacccggatgcctgttagttctcagcacagatattctacacctcacgccttcaccttt
aacacctccagtccctcatctgaaggttccctctcccagaggcagaggtcgacgtctaca
cctaatgtccatatggtcagcaccaccctgcctgtggacagcaggatgattgaggatgca
attcgaagtcacagcgaatcagcctcaccttcagccctgtccagtagccccaacaatctg
agcccaacaggctggtcacagcccaaaacccccttgccagcacaaagggagcgggcacca
ggatctggaacccaggagaaaaacaaaattagacctcgtggacagagagattcaagctat
tactgggaaatagaagccagtgaagtgatgctctccactcggattgggtcaggctctttt
ggaactgtttataagggcaaatggcatggagatgttgcagtaaagatcctaaaggttgtc
gacccaaccccagagcagttccaggccttcaggaatgaggtggctgttttgcgcaaaaca
cggcatgtgaacattctgcttttcatggggtacatgacaaaggacaacctggcaattgtg
acccagtggtgcgagggcagcagcctttacaaacacctgcatgtccaggagaccaagttt
cagatgttccagctaattgacattgcccggcagacggctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggccta
acagtgaaaattggagattttggtttggcaacagtaaagtcacgctggagtggttctcag
caggttgaacaacctactggctctgttctgtggatggctccagaggtgatccgaatgcag
gataacaacccattcagcttccagtcagatgtctactcctatggcatcgtattatatgag
ctgatgacaggggagcttccttactctcacattaacaaccgagatcagatcatcttcatg
gtgggccgagggtatgcctccccagatcttagtaagctatataagaactgccccaaagca
atgaagaggctggtagctgactgtgtcaagaaagtaaaggaagagaggcctctttttccc
cagattctgtcttccattgagctgctccagcactctctaccgaagatcaaccggagcgct
tccgagccatccttgcatcgggcagcccacactgaggatatcaatgcttgcacgctgacc
acatccccgaggctgcctgtcttctag

DBGET integrated database retrieval system