KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043647
Entry
101043647         CDS       T04350                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq01524  Platinum drug resistance
sbq04010  MAPK signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04110  Cell cycle
sbq04115  p53 signaling pathway
sbq04137  Mitophagy - animal
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04211  Longevity regulating pathway
sbq04216  Ferroptosis
sbq04218  Cellular senescence
sbq04310  Wnt signaling pathway
sbq04722  Neurotrophin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq05012  Parkinson disease
sbq05014  Amyotrophic lateral sclerosis
sbq05016  Huntington disease
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05216  Thyroid cancer
sbq05217  Basal cell carcinoma
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05220  Chronic myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101043647 (TP53)
   04310 Wnt signaling pathway
    101043647 (TP53)
   04071 Sphingolipid signaling pathway
    101043647 (TP53)
   04151 PI3K-Akt signaling pathway
    101043647 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101043647 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    101043647 (TP53)
   04210 Apoptosis
    101043647 (TP53)
   04216 Ferroptosis
    101043647 (TP53)
   04115 p53 signaling pathway
    101043647 (TP53)
   04218 Cellular senescence
    101043647 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101043647 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101043647 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    101043647 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101043647 (TP53)
   05202 Transcriptional misregulation in cancer
    101043647 (TP53)
   05206 MicroRNAs in cancer
    101043647 (TP53)
   05205 Proteoglycans in cancer
    101043647 (TP53)
   05203 Viral carcinogenesis
    101043647 (TP53)
   05230 Central carbon metabolism in cancer
    101043647 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101043647 (TP53)
   05212 Pancreatic cancer
    101043647 (TP53)
   05225 Hepatocellular carcinoma
    101043647 (TP53)
   05226 Gastric cancer
    101043647 (TP53)
   05214 Glioma
    101043647 (TP53)
   05216 Thyroid cancer
    101043647 (TP53)
   05220 Chronic myeloid leukemia
    101043647 (TP53)
   05217 Basal cell carcinoma
    101043647 (TP53)
   05218 Melanoma
    101043647 (TP53)
   05219 Bladder cancer
    101043647 (TP53)
   05215 Prostate cancer
    101043647 (TP53)
   05213 Endometrial cancer
    101043647 (TP53)
   05224 Breast cancer
    101043647 (TP53)
   05222 Small cell lung cancer
    101043647 (TP53)
   05223 Non-small cell lung cancer
    101043647 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101043647 (TP53)
   05014 Amyotrophic lateral sclerosis
    101043647 (TP53)
   05016 Huntington disease
    101043647 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101043647 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101043647 (TP53)
   05161 Hepatitis B
    101043647 (TP53)
   05160 Hepatitis C
    101043647 (TP53)
   05162 Measles
    101043647 (TP53)
   05168 Herpes simplex virus 1 infection
    101043647 (TP53)
   05163 Human cytomegalovirus infection
    101043647 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101043647 (TP53)
   05169 Epstein-Barr virus infection
    101043647 (TP53)
   05165 Human papillomavirus infection
    101043647 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101043647 (TP53)
   01522 Endocrine resistance
    101043647 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101043647 (TP53)
   03036 Chromosome and associated proteins [BR:sbq03036]
    101043647 (TP53)
   03400 DNA repair and recombination proteins [BR:sbq03400]
    101043647 (TP53)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    101043647 (TP53)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101043647 (TP53)
DNA repair and recombination proteins [BR:sbq03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    101043647 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD TAD2
Other DBs
NCBI-GeneID: 101043647
NCBI-ProteinID: XP_003929235
LinkDB
Position
Unknown
AA seq 393 aa
MEEPQSDLSIEPPLSQETFSDLWKLLPENNILSSSLSQPVDDLMLSPDDIAQWFSQDPVP
DESPTVSEAPPAVAQAPAAPTSAAPTPAPSWPLSSSVPSQKTYHGDYGFRLGFLHSGTAK
SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPRGTRVRAMAIYKQSQHMTEVVRRCPHHE
RCSDSDGLAPPQHLIRVEGNLHVEYLDDKNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS
SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCLDLP
PGSTKRAMPNSTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG
GSRAHSSHLKSKKGQCTSRHKKLMVKREGPDSD
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggaggagccgcagtcagatctcagcatcgagcccccgctgagtcaggaaacattttca
gacctatggaaactacttcctgaaaacaatattctgtcctcctcgctgtcccaaccggtg
gatgatttgatgctatccccggatgacattgcacaatggttcagtcaagacccggttcca
gatgaatctcccacagtatcagaggctcctcccgcggtggcccaggcaccggcagctcct
acatcagcggctcccacaccagccccctcctggcccctgtcatcctctgtcccttcccag
aaaacctaccatggtgactacggtttccgtctgggcttcttgcattctgggacagccaag
tctgtgacttgcacgtactcccctgccctcaacaagatgttttgccagctggccaagacc
tgccccgtgcagctgtgggtcgattccacacccccgcgtggcacccgcgtccgtgccatg
gccatctacaagcagtcacagcacatgacggaggtcgtgaggcgctgcccccaccatgag
cgctgctcagatagcgatggtctggcccctcctcagcatcttatccgagtggaaggaaat
ttacatgtggaatatttggatgacaaaaacacttttcgacatagtgtggtggtgccctat
gagccgcctgaggtcggctccgattgtaccaccattcactacaactacatgtgtaacagt
tcctgcatgggcggcatgaaccggaggcccatcctcaccatcatcacgctggaagactcc
agtggtaatctgctgggacggaacagctttgaggtgcgcgtttgtgcctgtcctgggaga
gaccggcgcacagaggaagagaatttccgcaagaaaggggagccttgccttgatctgccc
cctgggagcactaagcgagcaatgcccaacagcaccagttcctctccccagccaaagaag
aagccactggatggagaatatttcacccttcagatccgtgggcgtgagcgctttgagatg
ttccgagagctgaatgaggccttggaactcaaggatgcccaggctgggaaggagccaggg
ggaagcagggcccactccagccacctgaagtccaagaaggggcaatgtacctcccgccat
aaaaaactaatggtcaagagagagggacctgactcagactga

DBGET integrated database retrieval system