KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043776
Entry
101043776         CDS       T04350                                 

Gene name
PDGFB
Definition
(RefSeq) platelet-derived growth factor subunit B isoform X1
  KO
K17386  platelet-derived growth factor subunit B
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04510  Focal adhesion
sbq04540  Gap junction
sbq04630  JAK-STAT signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05200  Pathways in cancer
sbq05206  MicroRNAs in cancer
sbq05211  Renal cell carcinoma
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05231  Choline metabolism in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101043776 (PDGFB)
   04014 Ras signaling pathway
    101043776 (PDGFB)
   04015 Rap1 signaling pathway
    101043776 (PDGFB)
   04630 JAK-STAT signaling pathway
    101043776 (PDGFB)
   04020 Calcium signaling pathway
    101043776 (PDGFB)
   04072 Phospholipase D signaling pathway
    101043776 (PDGFB)
   04151 PI3K-Akt signaling pathway
    101043776 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101043776 (PDGFB)
   04540 Gap junction
    101043776 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101043776 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101043776 (PDGFB)
   05206 MicroRNAs in cancer
    101043776 (PDGFB)
   05231 Choline metabolism in cancer
    101043776 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    101043776 (PDGFB)
   05218 Melanoma
    101043776 (PDGFB)
   05211 Renal cell carcinoma
    101043776 (PDGFB)
   05215 Prostate cancer
    101043776 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101043776 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101043776 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101043776 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101043776 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101043776 (PDGFB)
Cytokines and growth factors [BR:sbq04052]
 Growth factors
  Growth factors (RTK binding)
   101043776 (PDGFB)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101043776 (PDGFB)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 101043776
NCBI-ProteinID: XP_003932904
UniProt: A0A2K6U7V3
LinkDB
Position
Unknown
AA seq 241 aa
MNRCWALFLSLCCYLRLVSAEGDPIPEEFYEMLSGHSIRSFDDLQRLLQGDSGEEDGAEL
DLNMTRSHSGGELESVARGRRSLGSLSVAEPATIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVAAARAVTRSPGSSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKMALKETLG
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttcctgtctctctgctgctacctgcgtctggtcagcgcc
gagggggaccccattcctgaggagttctatgagatgctgagtggccactcgatccgctcc
tttgatgacctccagcgcctgctgcagggagactccggagaggaagatggggctgagctg
gacctgaacatgacccgctcccattctggaggcgagctggagagtgtggctcgtgggaga
aggagcctgggttccctgagcgttgccgagccagccacgatcgctgagtgcaagacgcgc
accgaggtgttcgagatctcccggcgcctcatcgaccgcaccaacgccaacttcctggtg
tggccgccctgcgtggaggtgcagcgctgctctggctgttgcaacaaccgcaacgtgcaa
tgccggcccacccaggtgcagctgcggccagtccaggtgagaaagatcgagattgtgcgg
aagaagccaatctttaagaaggccacggtgacgctggaggaccacctggcatgcaagtgt
gagacagtggcggctgcacgggctgtgacccgaagcccggggagttcccaggagcagcga
gccaaaacgccccaaactcgggtgaccatccggacggtgcgagtccgccggccccccaag
ggcaagcaccggaaattcaagcacacgcatgacaagatggcactgaaggagaccctcgga
gcctag

DBGET integrated database retrieval system