KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043809
Entry
101043809         CDS       T04350                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04024  cAMP signaling pathway
sbq04137  Mitophagy - animal
sbq04210  Apoptosis
sbq04310  Wnt signaling pathway
sbq04380  Osteoclast differentiation
sbq04510  Focal adhesion
sbq04530  Tight junction
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04668  TNF signaling pathway
sbq04722  Neurotrophin signaling pathway
sbq04912  GnRH signaling pathway
sbq04915  Estrogen signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq05030  Cocaine addiction
sbq05031  Amphetamine addiction
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05135  Yersinia infection
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05161  Hepatitis B
sbq05162  Measles
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05224  Breast cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05321  Inflammatory bowel disease
sbq05323  Rheumatoid arthritis
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101043809 (JUN)
   04012 ErbB signaling pathway
    101043809 (JUN)
   04310 Wnt signaling pathway
    101043809 (JUN)
   04668 TNF signaling pathway
    101043809 (JUN)
   04024 cAMP signaling pathway
    101043809 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101043809 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    101043809 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101043809 (JUN)
   04530 Tight junction
    101043809 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101043809 (JUN)
   04621 NOD-like receptor signaling pathway
    101043809 (JUN)
   04625 C-type lectin receptor signaling pathway
    101043809 (JUN)
   04660 T cell receptor signaling pathway
    101043809 (JUN)
   04658 Th1 and Th2 cell differentiation
    101043809 (JUN)
   04659 Th17 cell differentiation
    101043809 (JUN)
   04657 IL-17 signaling pathway
    101043809 (JUN)
   04662 B cell receptor signaling pathway
    101043809 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101043809 (JUN)
   04915 Estrogen signaling pathway
    101043809 (JUN)
   04921 Oxytocin signaling pathway
    101043809 (JUN)
   04926 Relaxin signaling pathway
    101043809 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101043809 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101043809 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101043809 (JUN)
   05203 Viral carcinogenesis
    101043809 (JUN)
   05231 Choline metabolism in cancer
    101043809 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101043809 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101043809 (JUN)
   05211 Renal cell carcinoma
    101043809 (JUN)
   05224 Breast cancer
    101043809 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101043809 (JUN)
   05321 Inflammatory bowel disease
    101043809 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    101043809 (JUN)
   05031 Amphetamine addiction
    101043809 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101043809 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101043809 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101043809 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101043809 (JUN)
   05135 Yersinia infection
    101043809 (JUN)
   05133 Pertussis
    101043809 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101043809 (JUN)
   05170 Human immunodeficiency virus 1 infection
    101043809 (JUN)
   05161 Hepatitis B
    101043809 (JUN)
   05171 Coronavirus disease - COVID-19
    101043809 (JUN)
   05162 Measles
    101043809 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101043809 (JUN)
   05169 Epstein-Barr virus infection
    101043809 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101043809 (JUN)
   05142 Chagas disease
    101043809 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101043809 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101043809 (JUN)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    101043809 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha TFIIA FlaC_arch NBP1 Jnk-SapK_ap_N DUF3450
Other DBs
NCBI-GeneID: 101043809
NCBI-ProteinID: XP_003921548
LinkDB
Position
Unknown
AA seq 334 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctatgacgatgccctcaacgcctcattcctccag
tccgagagcggagcttatggctacagtaaccccaagatcctgaaacagagcatgaccctt
aacctggccgacccagtggggagcctgaagccgcacctccgcgccaagaactcggacctc
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctcata
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgacagatgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgag
ctgcacagccagaacacgcttcccagcgtcacgtcggcggcacagccggtcagcggggct
ggcatggtggctcccgcggtggcctcggtggcggggggcagcggcagcggcggcttcagc
gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaaccccggagcg
ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcaa
ccccagcagcagcagcagccgccgcagccgccccaccacttgccccagcagatgccggtg
cagcacccgcggctgcaggccctgaaggaggagcctcagacagtgccggagatgcctggc
gagacgccgcccctgtcccccatcgacatggagtcccaggagcgcatcaaggcggagagg
aagcgcatgaggaaccgcatcgctgcctccaagtgccgaaaaaggaagctggagagaatc
gcccggctggaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacg
gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac
agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system