KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043828
Entry
101043828         CDS       T04350                                 

Gene name
CPT1C
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, brain isoform
  KO
K19524  carnitine O-palmitoyltransferase 1, brain isoform [EC:2.3.1.21]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00071  Fatty acid degradation
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
sbq04152  AMPK signaling pathway
sbq04714  Thermogenesis
sbq04920  Adipocytokine signaling pathway
sbq04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101043828 (CPT1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101043828 (CPT1C)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101043828 (CPT1C)
   04920 Adipocytokine signaling pathway
    101043828 (CPT1C)
   03320 PPAR signaling pathway
    101043828 (CPT1C)
  09159 Environmental adaptation
   04714 Thermogenesis
    101043828 (CPT1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sbq03029]
    101043828 (CPT1C)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     101043828 (CPT1C)
Mitochondrial biogenesis [BR:sbq03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    101043828 (CPT1C)
SSDB
Motif
Pfam: Carn_acyltransf CPT_N
Other DBs
NCBI-GeneID: 101043828
NCBI-ProteinID: XP_010349489
LinkDB
Position
Unknown
AA seq 605 aa
MGWTPSMSNRSLFLMGLKLMFFLRPCTGFPPPTPPSESRESCTGRGRAMPPHHVPGRAGL
QRKMAEAHQAVGFRPSLTSDGAEVELSAPVLQEIYLSGLRSWKRHLSRFWNDFLTGVFPA
SPLSWLFLFSAIQLAWFLQLDPSLGLMEKIKELLPDWTIWGLPCPVVPPPARPQSPHCVS
LPCSQVSDWWEEFVYLRSRNPLMVNSNYYMMDFLYVTPTPLQAARAGNAIHALLLYRHRL
NRQEIPPTLLMGMRPLCSAQYEKIFNTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRVGT
HSRNSLLSPRALEQQFQRILDDPSPACPHEEHLASLTAAPRDTWAQVRTSLKTQAAEALE
VVEGAAFFVSLDAEPAGLTREDPAASLDAYAHALLAGRGHDRWFDKSFTLIVFSNGKLGL
SVEHSWADCPISGHMWEFTLATECFQLGYSADGHCKGHPDPTLPQPQRLQWDLPDQGPQD
PQCLALFRVAVDKHQALLKAAMSGQGVDRHLFALYIVSRFLHLQSPFLTQVGAQGKGQRG
SWETDSHRLGQHIEDALLDVASLFQAGQHFKRRFRGSREEDSRRRCGFLSRQTGASKTSM
TSPAL
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggggtggacaccgtcaatgtctaacaggagtttgtttcttatgggtctaaaactaatg
ttttttttaagaccctgcacgggtttccctcctccaaccccgccctccgaatctcgagag
tcctgtacggggagggggagggcaatgcccccgcaccacgttcctggcagagcagggctc
cagcgtaaaatggcagaagcgcaccaggccgtgggtttccgaccctcgctgacctcggat
ggggccgaagtggaactcagtgcccctgtgctgcaggagatatacctctctggcctgcgc
tcctggaaaaggcatctgtcacgtttctggaatgactttctcaccggtgtgttccctgcc
agccccctcagctggcttttcctcttcagtgctatccagcttgcctggttcctccagctg
gatccttccttgggactgatggagaagatcaaagagttgctgccggactggaccatctgg
gggcttccctgtcctgttgtccctcccccagcaaggccccagtcccctcactgtgtctct
ctaccctgctcccaggtcagtgactggtgggaggaatttgtgtacctgcgttcccgaaat
ccgctgatggtgaacagcaactattacatgatggacttcctgtatgtcacgcccacgcct
ctgcaggcagctcgcgctggaaacgccatccatgccctcctcctgtaccgccaccgcctg
aaccgccaggagatccccccgactttgctgatgggaatgcgtcccttatgctctgcccag
tatgagaagatcttcaacaccacgcggattccaggggtccaaaaagactacatccgccac
ctccacgacagccaacacgtggctgtcttccaccgaggccgattcttccgtgtggggacc
cactcccgaaacagcctgctttccccgagggccctggagcagcagtttcagcgaatcctg
gatgatccgtcaccagcctgcccccacgaggaacatctggcctctctgactgctgctccc
agagacacgtgggcccaggtgcggacgtccctgaagacccaggcagccgaggccctggag
gtggtggaaggggccgctttctttgtgtcgctggacgctgagcccgcggggctcaccagg
gaggacccggcggcgtcgttggatgcctatgcccatgccctgctggctggccggggccat
gaccgctggtttgacaaatccttcaccctaatcgtcttctccaatgggaagctggggctc
agcgtggagcactcctgggccgactgccccatctcaggacacatgtgggagttcactctg
gctacagaatgctttcagctgggctactcagcagacggccactgcaagggacacccggac
cctacactaccccagccccagcggctgcaatgggaccttccagaccagggaccccaggac
ccacagtgcctcgccctgttccgcgtggcagtagacaagcaccaggctctgctgaaggca
gccatgagcgggcagggagtggaccgtcacctcttcgcgctctacatcgtgtcccgattc
ctccacctgcagtcacccttcctgacccaggttggggcacagggaaagggtcagagaggg
agttgggagaccgactcccacaggctggggcagcacattgaggatgccctgttggatgtg
gcctccctgttccaggcggggcagcattttaagcgccggttcagaggttcaagggaggag
gactcaaggcgcaggtgtggatttctttcccgccagactggggcctccaagacatctatg
acatccccggcactctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044692
Entry
101044692         CDS       T04350                                 

Gene name
CPT1A
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00071  Fatty acid degradation
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
sbq04152  AMPK signaling pathway
sbq04714  Thermogenesis
sbq04920  Adipocytokine signaling pathway
sbq04922  Glucagon signaling pathway
sbq04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101044692 (CPT1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101044692 (CPT1A)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101044692 (CPT1A)
   04920 Adipocytokine signaling pathway
    101044692 (CPT1A)
   03320 PPAR signaling pathway
    101044692 (CPT1A)
  09159 Environmental adaptation
   04714 Thermogenesis
    101044692 (CPT1A)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101044692 (CPT1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sbq03029]
    101044692 (CPT1A)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     101044692 (CPT1A)
Mitochondrial biogenesis [BR:sbq03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    101044692 (CPT1A)
SSDB
Motif
Pfam: Carn_acyltransf CPT_N
Other DBs
NCBI-GeneID: 101044692
NCBI-ProteinID: XP_010350299
LinkDB
Position
Unknown
AA seq 723 aa
MAEAHQAVAFQFTVTPDGIDLRLSHEALKQIYLSGLHSWKKKFIRFKNGIITGVYPASPS
SWLIVVVGVMTTMYAKIDPSLGIIAKINRTLERTDCMSSQTKNVVSGVLFGTGLWVALIV
TMRFSLKVLLSYHGWMFAEHGKMSRATKIWMGMVKLFSGRKPMLYSFQTSLPRLPVPAVK
DTVNRYLESVRPLMKEEDFKRMTALAQDFAVSLGPRLQWYLKLKSWWATNYDLLYVIPTH
IQAARAGNAIHAILLYRRKLDREEIKPIRLLGSTIPLCSAQWERMFNTSRIPGEETDTIQ
HMRDSKHIVVYHRGRYFKVWLYHDGRLLKPREMEQQMQRILDDPSEPQPGEARLAALTAG
DRVPWARCRQAYFGRGKNKQSLDAVEKAAFFVTLDETEQGYRREDPDTSMDSYAKSLLHG
RCYDRWFDKSITFVVFKNGKMGMNAEHSWADAPIVAHLWEYVLSTDSLQMGYAEDGHCKG
DTNPNIPYPTRLQWDIPGESTILADLPSPSVHFRHISLPCHVLKYLLSPQDMGKFCLTYE
ASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQLMYRLAMTG
SGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLERNPEYVSSGG
GFGPVADDGYGVSYILVGENLINFHISSKFSCPETDSHRFGKHLREAMIDIITLFGLSSN
SKK
NT seq 2172 nt   +upstreamnt  +downstreamnt
atggcagaagctcaccaagctgtggccttccagttcacggtcactccagacgggattgac
ctacggctgagccatgaagcccttaaacagatctatctttctggacttcactcctggaaa
aagaagttcatcagattcaagaatggcatcatcactggcgtgtacccggcgagcccctcc
agttggcttatcgtggtggtgggcgtgatgacgacgatgtatgccaagatcgacccctca
ttaggaataattgcaaaaatcaatcggaccctggaaaggaccgactgcatgtccagccag
acgaagaacgtggtcagcggcgtgctgttcggcaccgggctgtgggtggccctcatcgtc
accatgcgcttctccctgaaagtgctgctctcataccacgggtggatgttcgctgagcat
ggcaagatgagtcgcgccaccaagatctggatgggtatggtcaagctcttttcaggccga
aagcccatgctgtacagcttccagacgtcgctgcctcgcctgccggtcccggctgtcaaa
gacactgtgaacaggtatctagaatctgtgaggcctctcatgaaggaagaggacttcaaa
cggatgacggcacttgctcaagattttgctgtcagtcttggaccaagattacagtggtat
ctgaagttgaaatcctggtgggctacaaattacgatctgctgtatgttattccaactcac
attcaggcagcaagagcgggcaacgccatccacgccatcctgctgtacaggcgcaaactg
gaccgggaggaaatcaaaccaattcgtcttctgggatccaccattccactctgctcggct
cagtgggagcggatgtttaatacttcccggatcccaggagaggagacagacaccatccag
cacatgagagacagcaagcacatcgttgtgtaccatcgagggcgctacttcaaggtctgg
ctctatcatgacgggcggctgctgaagccccgggagatggagcagcagatgcagaggatt
ttggacgacccctcagagcctcagcccggggaggccaggctggcggccctcaccgcagga
gacagagttccctgggccaggtgtcgccaggcctattttgggcgtgggaaaaataagcag
tctcttgatgccgtggagaaagcagcgttcttcgtgacattagatgaaactgagcaagga
tacagaagggaagacccagatacgtcaatggacagctatgccaagtctctactgcatggc
cggtgttacgacaggtggtttgacaagtccatcacgtttgttgtcttcaaaaacgggaag
atgggcatgaacgcagagcactcctgggcagacgcaccaatcgtggctcacctttgggag
tacgtcctgtccactgacagcctccagatgggctatgcggaggacgggcactgcaaaggc
gacaccaatccgaacattccgtaccccaccaggctgcagtgggacatcccaggggaatct
actatcctcgccgacctccccagtccttcagtacattttagacatatcagcctgccctgc
catgtgctaaagtaccttctctctccccaggacatgggcaagttctgcctcacatacgaa
gcctccatgacccggctcttccgagaggggaggacggagacagtgcgctcctgcaccact
gagtcgtgtgacttcgtgcgggccatggtggacccggctcagacggtggaacagaggctg
aaattgttcaagttggcatctgagaagcatcagctgatgtatcgcctcgccatgactggc
tctgggatcgatcgtcacctcttctgcctctacgtggtgtctaaatatctcgctgtggag
tcccctttcctcaaggaagttttatctgagccttggagattatcaacaagccagacccct
cagcagcaagtggagctgtttgacttggagaggaacccggagtacgtgtctagcggaggg
ggctttggaccggttgctgacgacggctatggtgtgtcatacatcctcgtgggagagaac
ctcatcaatttccacatttcctccaagttctcttgccctgagacggattctcatcgcttt
ggaaagcacctgagagaagcaatgattgacatcatcactttgttcgggctaagttctaat
tccaaaaagtaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045068
Entry
101045068         CDS       T04350                                 

Gene name
CPT1B
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, muscle isoform isoform X1
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00071  Fatty acid degradation
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
sbq04152  AMPK signaling pathway
sbq04714  Thermogenesis
sbq04920  Adipocytokine signaling pathway
sbq04922  Glucagon signaling pathway
sbq04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101045068 (CPT1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101045068 (CPT1B)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101045068 (CPT1B)
   04920 Adipocytokine signaling pathway
    101045068 (CPT1B)
   03320 PPAR signaling pathway
    101045068 (CPT1B)
  09159 Environmental adaptation
   04714 Thermogenesis
    101045068 (CPT1B)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101045068 (CPT1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sbq03029]
    101045068 (CPT1B)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     101045068 (CPT1B)
Mitochondrial biogenesis [BR:sbq03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    101045068 (CPT1B)
SSDB
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Other DBs
NCBI-GeneID: 101045068
NCBI-ProteinID: XP_003932839
UniProt: A0A2K6UEZ4
LinkDB
Position
Unknown
AA seq 772 aa
MAEAHQAVAFQFTVTPEGVDFRLSREALKHIYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVVMATVGSSYCNVDISLGLVGCIQRCLPRGCGPYQTPQTQALLSMAIFSTGVWATG
IFFFRQTLKLLLSYHGWMFEMHGKTSHLTRIWAICIRLLSSRRPMLYSFQTSLPKLPVPR
VSATIQRYLESVRPLLDDEEYYRMEMLAKEFKEKTAPRLQKYLVLKSWWATNYVSDWWEE
YIYLRGRSPLMVNSNYYVMDLVLIRNTDVQAARLGNIIHAMIMYRRKLDREEIKPVMALG
IVPMCSYQMERMFNTTRIPGKETDTLQHLSDSRHVAVYHKGRFFKLWLYEGSRLLQPRDL
EMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVA
LDEESYWYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPI
IGHLWEFVLGTDSFHLGYTETGHCLGKPNPALAPPMRLQWDIPKQCQAVIESSYQVAKAL
ADDVELYCFQFLPFGKGLIKRCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREG
RTETVRSCTSESTAFVQAMMEGSHMKADLRDLFQKASKKHQNMYRLAMTGAGIDRHLFCL
YLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQIRMFDPEQHPNHLGAGGGFGPVADDGY
GVSYMIAGENTIFFHVSSKFSSSETNAQRFGNHIRQALLDIADLFQVPKADS
NT seq 2319 nt   +upstreamnt  +downstreamnt
atggcggaagcgcaccaggccgtggccttccagttcacggtgaccccagaaggggtcgac
ttccggctcagtcgggaggccctgaaacacatctacttgtctgggatcaactcctggaag
aaacgcctgatccgcatcaagaatggcatcctcaggggcgtataccctggcagccccacc
agctggctggtcgtcgtcatggcaacagtgggttcctcctactgcaacgtggacatctcc
ttggggctggtcggttgcatccagagatgcctccctcgggggtgtgggccctaccagacc
ccgcagacccaggcacttctcagcatggccatcttctccacgggcgtctgggcaacaggc
atcttcttcttccgccaaactctgaagctgctgctttcctaccatgggtggatgtttgag
atgcatggcaagaccagccacttgaccaggatctgggctatatgtatccgccttctatcc
agccggcgccccatgctctacagcttccagacatctctgcccaagcttcctgtgcccagg
gtgtcagccacaattcagcggtacctagagtctgtgcggcccttgttggatgatgaggaa
tattaccgaatggagatgctggctaaagaattcaaggagaagactgcccccaggctgcag
aaatatctggtgctcaagtcatggtgggcaactaactatgtgagtgactggtgggaagag
tacatttaccttcgaggcaggagccctctcatggtgaacagcaactattatgtcatggac
cttgtgctcatcaggaatacagacgtgcaggcggcccgtctgggaaacatcatccatgcc
atgatcatgtatcgccgtaaacttgaccgtgaagaaatcaagcctgtgatggcactgggc
atcgtgcccatgtgctcctaccagatggagaggatgttcaacaccactcggatcccgggc
aaggagacagatacgctacaacacctctcagacagccggcatgtggctgtctaccacaag
ggacgcttcttcaagctgtggctttatgagggctcccgtctgctccagcctcgggatctg
gagatgcagttccagagaatcctggatgacccctccccgcctcagcctggggaggagaag
ctggcagccctcactgcaggaggaagggtggagtgggcacaggcacgccaggccttcttt
agctctggaaagaacaaggctgccttggaggccattgagcgtgctgctttctttgtggcc
ctggatgaggagtcctactggtacgaccccgaagacgaggccagcctcagcctctatggc
aaggccctgctacatggcaactgctacaacaggtggtttgacaaatccttcactctcatt
tccttcaagaatggccagttgggtctcaatgcagaacatgcatgggcagatgctcccatc
attggacacctctgggagtttgtcctgggcacagacagcttccacctgggctacacagag
actgggcattgcctgggcaaaccaaaccctgctctggcacctcctatgcgactgcagtgg
gacattccaaaacagtgccaggcagtcatcgagagttcgtaccaggtggccaaggcactg
gcagatgatgtggagttgtactgcttccagtttctgccctttggcaaaggcctcatcaag
aggtgccggaccagcccggacgcctttgtgcagattgcactgcagctggctcacttccgg
gacaggggtaagttctgcctgacctatgaggcctcaatgaccagaatgttccgggaggga
cggactgagactgtgcgttcctgtaccagcgagtccacagcctttgtgcaggccatgatg
gaggggtcccacatgaaagcagacctgcgcgatctcttccagaaagcttctaagaagcac
cagaatatgtaccgcctggccatgacaggggcagggatcgacaggcacctcttctgcctt
tacttggtctccaagtacctgggagtcagctctcctttcctagctgaggtgctctcagaa
ccctggcgcctctccaccagccagatccctcagtcacagatccgcatgttcgatccagaa
cagcaccccaaccacctgggtgctggaggtggctttggccctgtagcagatgatggctat
ggggtttcctacatgatcgcaggcgagaacacgatcttcttccatgtctccagcaagttc
tcaagctcagagacgaatgcccagcgctttgggaaccacatccgccaagccctactggac
atcgctgatcttttccaagttcccaaggctgacagctga

DBGET integrated database retrieval system