KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043858
Entry
101043858         CDS       T04350                                 

Gene name
HMGCS2
Definition
(RefSeq) hydroxymethylglutaryl-CoA synthase, mitochondrial
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00072  Synthesis and degradation of ketone bodies
sbq00280  Valine, leucine and isoleucine degradation
sbq00650  Butanoate metabolism
sbq00900  Terpenoid backbone biosynthesis
sbq01100  Metabolic pathways
sbq03320  PPAR signaling pathway
Module
sbq_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101043858 (HMGCS2)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    101043858 (HMGCS2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101043858 (HMGCS2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    101043858 (HMGCS2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101043858 (HMGCS2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     101043858 (HMGCS2)
SSDB
Motif
Pfam: HMG_CoA_synt_N HMG_CoA_synt_C ACP_syn_III
Other DBs
NCBI-GeneID: 101043858
NCBI-ProteinID: XP_010331251
LinkDB
Position
Unknown
AA seq 496 aa
MQRLLTPVKRILQLTRVMQEASLTPARLLPAAHQRFSTVSAVPLAKTDTWPKDVGILALE
VYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTHMGFCSVQEDINSLCLTVVQRLMERMQLP
WDSVGRLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWM
ESSAWDGRYAMVVCGDIAVYPSGNARPTGGAGAVAMLIGPKAPLALEQGLRGTHMENVYD
FYKPNLASEYPMVDGKLSIQCYLRALDRCYAAYRQKIQNQWKQAGNDRPFTLDDLQYMIF
HTPFCKMVQKSLARLMFNDFLSASRDTQSSLYKGLEDFRGLKLEDTYNNKDLDKALVKAS
QDMFNKKTKASLYLSTHNGNMYTSSLYGCLASLLSHVSCLYVLLIMLLTYHFWSCFGFPG
SPLDKLVSSTSDLPKRLASRKRVSAEEFTEVMNQREQFYHKVNYSPPGDTSSLFPGTWYL
ERVDELHRRTYARRPV
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgcagcgtctgttgactccagtgaagcgcatcctgcagctgacaagagtgatgcaggaa
gcctccctcacacctgctcgcctgctcccagcagcccaccaaaggttttctacagtctct
gctgtccccctggccaaaacagatacttggccaaaggacgtgggcatcctggccctggaa
gtctacttcccagcccaatatgtggaccaaactgacctggagaagtataacaatgtggaa
gcaggaaagtatacagtgggcttgggtcagacccatatgggcttctgctcagtccaagag
gatatcaactccctgtgcctgacagtggtgcaacggctgatggaacgcatgcagctccct
tgggactccgtgggccggctggaagtgggcactgagaccatcattgacaagtccaaagcc
gtcaaaacagtgctcatggaactcttccaggattcgggcaatactgatattgaggggata
gataccaccaatgcctgctatggtggtactgcctccctcttcaatgctgccaactggatg
gaatccagtgcctgggatggtcgctatgcgatggtggtctgtggagacatcgccgtctat
cccagtggtaatgctcgtcccacaggtggggccggagctgtggccatgctgattgggccc
aaggcccctctggccctggagcaagggctgaggggaacccatatggagaatgtgtatgac
ttctacaaaccaaatttggcctcagagtacccaatggtggatggaaagctctccatccag
tgctacctgcgggccttggaccgatgttacgcagcataccgtcaaaaaatccagaatcag
tggaagcaagctggcaatgatcgacccttcacccttgacgatttacagtacatgatcttt
cacacacccttttgcaagatggtccagaagtctctggctcgcctgatgttcaatgacttc
ttgtcagccagcagggacacacagagcagcttatataaggggctggaggatttcaggggc
ctaaagctggaagacacctacaacaacaaggacctggataaagcacttgtaaaggcctct
caggacatgttcaacaagaaaaccaaggcgtctctgtacctctccacgcacaatgggaat
atgtacacctcatccctgtacgggtgcctggcctcgcttctgtcccatgtgtcttgcctg
tatgttttgctgataatgctgcttacttatcatttctggtcttgctttggcttcccaggc
tctcccttggacaagttggtgtccagcacatcagacctgccaaaacgcctggcctcccga
aagcgtgtgtctgctgaggagttcacagaagtaatgaaccaaagagagcaattctaccat
aaggtgaactactccccacctggtgacacaagcagccttttccccggtacctggtacctg
gagcgggtggacgagctgcaccgccgaacgtatgcccggcgtcccgtttaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101050199
Entry
101050199         CDS       T04350                                 

Gene name
HMGCS1
Definition
(RefSeq) hydroxymethylglutaryl-CoA synthase, cytoplasmic
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00072  Synthesis and degradation of ketone bodies
sbq00280  Valine, leucine and isoleucine degradation
sbq00650  Butanoate metabolism
sbq00900  Terpenoid backbone biosynthesis
sbq01100  Metabolic pathways
sbq03320  PPAR signaling pathway
Module
sbq_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101050199 (HMGCS1)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    101050199 (HMGCS1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101050199 (HMGCS1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    101050199 (HMGCS1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101050199 (HMGCS1)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     101050199 (HMGCS1)
SSDB
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N Cullin ACP_syn_III
Other DBs
NCBI-GeneID: 101050199
NCBI-ProteinID: XP_003925935
UniProt: A0A2K6SK66
LinkDB
Position
Unknown
AA seq 520 aa
MPGSLPLNAEACWPKDVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQAKMGFCT
DREDINSLCLTVVQNLMERNNLSYDCIGRLEVGTETIIDKSKSVKTNLMQLFEESGNTDI
EGIDTTNACYGGTAAVFNAVNWIESSSWDGRYALVVAGDIAVYATGNARPTGGVGAVALL
IGPNAPLIFERGLRGTHMQHAYDFYKPDMLSEYPIVDGKLSIQCYLSALDRCYAVYCKKI
RAQWQKEGNDKDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNTIYSGLEA
FGDVKLEDTYFDRDVEKAFMKASSELFNQKTKASLLVSNQNGNMYTSSVYGSLASVLAQY
SPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTCVAP
DVFAENMKLREDTHHLVNYIPQGSIDSLFEGTWYLVRVDEKHRRTYARRPTPNDDTLDEG
VGLVHSNTATEHIPSPAKKVPRLPATAAEPEAAVISNGEH
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgcctgggtcacttcctttgaatgcagaagcttgctggccaaaagatgtgggaattgtt
gcccttgagatctattttccttctcaatatgttgatcaagcagagttggaaaaatatgat
ggtgtagatgctggcaagtataccattggcttgggccaggccaagatgggcttctgcaca
gatagagaagatatcaactctctttgcctgactgtggttcagaatcttatggagagaaat
aacctttcctatgattgcattgggcggctggaagttggaacagagacaatcatcgacaaa
tcaaagtcagtgaagactaatttgatgcagctgtttgaagagtctgggaatacagatata
gaaggaattgatacaactaatgcatgctatggaggcacggctgcggtcttcaatgctgtt
aactggatagagtccagctcttgggatggacggtatgccctggtagttgcaggagatatt
gctgtatacgccacaggaaatgctagacctacaggtggagttggagcagtagctctgcta
attgggccaaatgctcctttaatttttgaacgaggacttcgtgggacacatatgcaacat
gcctatgatttttacaagcctgatatgctatctgaatatcctatagtagatggaaagctc
tccatacagtgctacctcagtgcactagatcgttgctatgctgtctactgcaaaaagatc
cgtgcccaatggcagaaagagggaaatgataaagattttaccttgaatgattttggcttc
atgatctttcactcaccatattgtaagctggttcagaaatctctagctcggatgttgctg
aatgacttccttaatgaccaaaatagagataaaaatactatctatagtggcctggaagcc
tttggggatgttaaattagaagacacctactttgatagagatgtggagaaggcatttatg
aaggctagttctgaactcttcaatcagaaaacaaaggcatctttgcttgtatcaaatcaa
aatggaaatatgtacacatcttcagtatatggttcccttgcatctgttctagcacagtac
tcacctcagcaattagcagggaagagaattggagtgttttcttatggttctggtttggct
gccactctctactctcttaaagttacacaagatgctacaccagggtctgctcttgataaa
ataacggcaagtttatgtgatcttaaatcaaggcttgattcaagaacttgtgtggcacca
gatgtctttgctgaaaacatgaagctcagagaggacacccatcatttggtcaactatatt
ccccagggttcaatagattcactctttgaaggaacgtggtacttagttagggtggatgaa
aagcacagaagaacttacgctcggcgtcccactccaaatgatgacactttggatgaagga
gtaggacttgtgcattcaaacacagcaactgagcatattccaagccctgccaagaaagtg
ccaagactccctgccacagcagcagaacctgaagcagctgtcattagtaatggggaacat
taa

DBGET integrated database retrieval system