KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043897
Entry
101043897         CDS       T04350                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq04664  Fc epsilon RI signaling pathway
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05221  Acute myeloid leukemia
sbq05310  Asthma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101043897 (IL3)
   04151 PI3K-Akt signaling pathway
    101043897 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101043897 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101043897 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101043897 (IL3)
   04664 Fc epsilon RI signaling pathway
    101043897 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101043897 (IL3)
   05202 Transcriptional misregulation in cancer
    101043897 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101043897 (IL3)
  09163 Immune disease
   05310 Asthma
    101043897 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101043897 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101043897 (IL3)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101043897 (IL3)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Haparin
  Cytokines
   101043897 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 101043897
NCBI-ProteinID: XP_003920669
UniProt: A0A2K6SKY4
LinkDB
Position
Unknown
AA seq 135 aa
MSHLLILLLLLLVSPGLQAAPIQTTPLKTTQVNCSNLREEIVTLLNQPPLPSSNFSNLNW
EDQRILMKPNLRRPNLKAFQKAIKSLQNATAIESNLKDLSLCLPTATDAPTQHPIRIKDG
DWNDFRVKLKFYLKF
NT seq 408 nt   +upstreamnt  +downstreamnt
atgagccacctgctcatcctgctcctcctactcctggtcagccccggacttcaagctgcc
ccaatccagacaacgcccttgaagacaactcaggttaactgctctaacttgagggaggaa
attgtgacactcctaaaccagccacctttgccttcatcaaacttcagcaacttaaactgg
gaagaccaacgcattctgatgaaaccaaaccttcgaaggccaaacctgaaagcattccag
aaggccatcaagagtttacagaatgcaacagcaattgagagcaatcttaaggatctctca
ctatgcctgcccacggccacggatgcaccaacgcaacatccaatccgtatcaaggacggt
gactggaatgacttccgggtgaaactgaagttctatttgaagttctaa

DBGET integrated database retrieval system