KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043935
Entry
101043935         CDS       T04350                                 

Gene name
TLR4
Definition
(RefSeq) toll-like receptor 4 isoform X1
  KO
K10160  toll-like receptor 4
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04064  NF-kappa B signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04145  Phagosome
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05134  Legionellosis
sbq05135  Yersinia infection
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05144  Malaria
sbq05145  Toxoplasmosis
sbq05146  Amoebiasis
sbq05152  Tuberculosis
sbq05161  Hepatitis B
sbq05162  Measles
sbq05164  Influenza A
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05205  Proteoglycans in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05321  Inflammatory bowel disease
sbq05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101043935 (TLR4)
   04066 HIF-1 signaling pathway
    101043935 (TLR4)
   04151 PI3K-Akt signaling pathway
    101043935 (TLR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101043935 (TLR4)
  09143 Cell growth and death
   04217 Necroptosis
    101043935 (TLR4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101043935 (TLR4)
   04621 NOD-like receptor signaling pathway
    101043935 (TLR4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101043935 (TLR4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101043935 (TLR4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101043935 (TLR4)
   05321 Inflammatory bowel disease
    101043935 (TLR4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101043935 (TLR4)
   05135 Yersinia infection
    101043935 (TLR4)
   05133 Pertussis
    101043935 (TLR4)
   05134 Legionellosis
    101043935 (TLR4)
   05152 Tuberculosis
    101043935 (TLR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101043935 (TLR4)
   05161 Hepatitis B
    101043935 (TLR4)
   05171 Coronavirus disease - COVID-19
    101043935 (TLR4)
   05164 Influenza A
    101043935 (TLR4)
   05162 Measles
    101043935 (TLR4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101043935 (TLR4)
   05144 Malaria
    101043935 (TLR4)
   05145 Toxoplasmosis
    101043935 (TLR4)
   05140 Leishmaniasis
    101043935 (TLR4)
   05142 Chagas disease
    101043935 (TLR4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101043935 (TLR4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:sbq04054]
    101043935 (TLR4)
   04090 CD molecules [BR:sbq04090]
    101043935 (TLR4)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101043935 (TLR4)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    101043935 (TLR4)
Pattern recognition receptors [BR:sbq04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   101043935 (TLR4)
CD molecules [BR:sbq04090]
 Proteins
  101043935 (TLR4)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Hyaluronan
  Cell surface receptors
   101043935 (TLR4)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_5 LRR_9 LRR_6 DUF1863 Curto_V2
Other DBs
NCBI-GeneID: 101043935
NCBI-ProteinID: XP_003925236
UniProt: A0A2K6TZ72
LinkDB
Position
Unknown
AA seq 832 aa
MMPASCLAGALIPAMAFLSCVRPESWEPCVEVVPNVTYQCMELNFYKIPDNIPFSTKNLD
LSFNPLRHLGSHSFFNFPELQVLDLSRCDIQTIEDGAYQSLSHLSTLILTGNPIQNLALG
AFSGLSSLQKLVAVETHLLSLENFPIGHLKTLKDLNVAHNLIQSFKLPEYFSNLTNLEHL
DLSSNNIQNIYCKDLQVLHQMPLLNLSLDLSLNPINFIQPGAFKEIRLHKLTLRNNFDSL
NAMKTCIQGLAGLEVHRLVLGEFRNERNIEDFDKSALEGLCNLTINEFRLAYLDDFLDDI
IDLFNCLANVSSFSLVNVHIKRVEDFSYNFRWQHLELVNCVFQQFPPLKLKSLKRLTFTA
NKGRNHFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNDVITMGSNFLG
LEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLFSLKVLKMAG
NSFQQNFLEDIFTDLNNLIFLDVSECQLEQLSPTAFDSLPRLRILNMSHNNFFALDTFPY
KHLYSLQVLDYSLNHIGTSKNQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRRL
LVEVEQMECATPLNRKGIPVLSLNITCQMSKTIIGVSVLSVLVVSVVAVLVYKFYFHLML
LAGCIKYGRGENTYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAA
NIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKSLLR
QQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGRPWNPEGTVGAGCE
NT seq 2499 nt   +upstreamnt  +downstreamnt
atgatgcctgcttcatgcctggctggggctctgatcccagccatggccttcctctcctgc
gtgagacctgaaagctgggagccctgcgtggaggttgttcctaacgttacttatcaatgc
atggaactgaatttctacaaaatccccgacaacatccccttctcaactaagaacctggac
ctgagctttaacccactgaggcatttaggcagccatagcttcttcaatttcccagaactg
caggtgctggatttatccaggtgtgacatccagacaatcgaagatggggcatatcagagc
ctaagccacctctccaccttaatattgacaggaaatcctatccagaatttagccctggga
gccttttctggactatcaagtttacagaagctggtggctgtggagacacatctgttatca
ctagagaacttccccattggacatctcaaaactttgaaggaccttaatgtggctcacaat
ctaatccaatctttcaaattacctgagtatttttctaatctgaccaatctagagcacttg
gacctttctagtaacaatattcaaaatatttattgcaaagacttgcaggttctacatcaa
atgcccctactcaatctctctttagacctgtccctgaaccctataaactttattcaacca
ggtgcgtttaaagaaattaggctccataagctgactttgagaaataattttgatagttta
aatgcaatgaaaacttgcattcaaggtctggctgggttagaagtccatcgtttggttctg
ggagaatttagaaatgaaagaaatattgaagactttgacaaatctgctctggagggcctg
tgcaatttgaccattaatgaattccgattagcttacttagatgactttctagatgatatt
attgacttatttaactgtttagcaaatgtttcttcattttccctggtgaatgtgcatatt
aaaagagtagaagacttttcttataattttagatggcaacatttagaattagttaactgt
gtatttcaacagtttcctccactgaaactcaaatctctcaaaaggcttactttcactgcc
aacaaaggtaggaatcatttttcagaagttgatcttccaagccttgagtttctagatctc
agtagaaatggcttgagtttcaaaggttgctgttctcaatctgattttgggacgaccagc
ctaaagtatttagatctgagcttcaatgacgttattaccatgggttcaaacttcttaggc
ttagaacaactagaacacttggatttccagcattccaatttgaaacaaatgagtgagttt
tcagtattcctatcactcagaaacctcatttaccttgacatttctcatactcacaccaga
gttgctttcaatggcatctttaatggcttgttcagtctcaaagtcttgaaaatggctgga
aattctttccagcaaaacttccttgaagatatcttcacggatctgaataacttgatattc
ctggacgtctctgagtgtcagctggagcagttgtctccaacagcatttgactcacttccc
agacttcggatactaaatatgagccacaacaacttctttgcattggatacattcccttac
aagcatctctactccctccaggttctggattacagtctcaatcatatagggacttccaaa
aatcaggaactgcagcattttccaagtagtctagctttcttaaatcttactcaaaatgac
tttgcttgtacttgtgaacaccagagtttcctgcagtggatcaaggaccagaggcggctg
ttggtggaagttgaacaaatggaatgtgcaacacctttaaataggaagggcatacctgtg
ctgagtttgaatatcacctgtcagatgagtaagactatcattggtgtgtcagtgctcagt
gtgcttgtggtatctgttgtagcagttctggtctataagttctattttcacctgatgctt
cttgctggctgcataaagtatggtagaggtgaaaacacctatgatgcctttgttatctac
tcaagccaggatgaggactgggtaaggaatgaactagtaaagaatttagaagaaggggtg
cctccctttcagctctgccttcactacagagactttattcccggtgtggccattgctgcc
aacatcatccatgaaggtttccataaaagccggaaggtgattgttgtggtatctcagcac
ttcatccagagccgctggtgtatctttgaatatgagattgctcagacctggcagtttctg
agcagtcgtgctggtatcatcttcattgtcctgcagaaggtggagaagtccctgctcagg
cagcaggtggagctgtaccgccttctcagcaggaacacttacctggagtgggaggacagt
gtcctggggaggcacatcttctggagacgactcagaaaagccctgctggatggtagaccg
tggaatccagaaggaacagtgggtgcaggatgcgaatag

DBGET integrated database retrieval system