KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044013
Entry
101044013         CDS       T04350                                 

Gene name
MSH2
Definition
(RefSeq) DNA mismatch repair protein Msh2
  KO
K08735  DNA mismatch repair protein MSH2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01524  Platinum drug resistance
sbq03430  Mismatch repair
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    101044013 (MSH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101044013 (MSH2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101044013 (MSH2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101044013 (MSH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sbq03400]
    101044013 (MSH2)
DNA repair and recombination proteins [BR:sbq03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     101044013 (MSH2)
SSDB
Motif
Pfam: MutS_V MutS_IV MutS_III MutS_II MutS_I AAA_27
Other DBs
NCBI-GeneID: 101044013
NCBI-ProteinID: XP_010332042
LinkDB
Position
Unknown
AA seq 819 aa
MAVQPKETLQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTVHGEDALLAAREVFKT
QGVIKYMGPAGEDRDGECWGGTRGLWRDSIPASESGRRTASPAWGRDVGAPALASPGNLS
QFEDVLFGNNDTSASIGVVGVKMSTVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEA
LLIQIGPKECVLPGGETAGDMGKLRQIIQRGGILITEKKKADFSTKDIYQDLNRLLKGKK
GEQMNSAVLPEMENQGSVEDTTGSQSLAALLNKCKTPQGQRLVNQWIKQPLMDKNRIEER
SFYLFYYFLLGKHQKLLLAVFVTPLTDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFD
PNLSELREIMNDLEKKMQSTLISAARDLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRN
NKNFTTVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQDAIVKEIVNISSGYVEPMQTL
NDVLAQLDAVVSFAHVSNGAPVPYVRPVILEKGQGRIILKASRHACVEVQDEVAFIPNDV
YFEKNKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAG
DSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIG
AFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELAN
FPKHVIECAKQKALELEEFQYIGESQGYDNMEPATKRCYLEREQGEKIIQEFLSKVKQMP
FTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTV
NT seq 2460 nt   +upstreamnt  +downstreamnt
atggcggtgcagccgaaggagacgctgcagctggagagcgcggccgaggtcggcttcgtg
cgcttctttcaaggcatgccggaaaagccgaccactacggtgcgccttttcgaccggggc
gacttctatacggtgcacggcgaggacgcgctgctggcggcccgggaagtgttcaagacc
cagggggtgatcaagtacatggggccggcaggtgaggaccgggacggcgagtgctgggga
gggacccggggcttgtggcgcgactccattcccgcctcggaaagtgggcggcgaacagcc
tctccagcatgggggcgggacgttggtgccccggcgctcgcttctcctggcaatctgtct
cagtttgaagacgttctcttcggtaacaatgatacgtcagcttccattggtgttgtgggt
gttaaaatgtccacagttgatggccagagacaggttggagttggctatgtggattccata
cagaggaagctaggactgtgtgaattccctgataatgatcagttctccaatcttgaggct
ctcctgatccagattggaccaaaggaatgtgttttacctggaggagagactgctggagac
atggggaaactgaggcagattattcaaagaggaggaattctgatcacagaaaaaaaaaaa
gctgacttttccacaaaagacatttatcaggacctcaaccggttgttgaaaggcaaaaag
ggagaacagatgaatagtgctgtattgccagaaatggagaatcagggttctgttgaagat
accactggctctcagtctctggctgccttgctgaataagtgtaaaaccccccaaggacaa
agacttgttaaccagtggattaagcagcctcttatggataagaacagaatagaggagagg
tctttttatttgttttactactttcttttaggaaaacaccagaaattgttgttggcagtt
tttgtgactcctcttactgatcttcgttctgatttctccaagtttcaggaaatgattgaa
acaactttagatatggatcaggtggaaaaccatgaattccttgtaaaaccttcatttgat
cctaatctcagtgaattaagagaaataatgaatgacttggaaaagaagatgcagtcaaca
ttaataagtgcagccagagatcttggcttggaccctggcaaacagattaaactggattcc
agtgcacagttcggatattactttcgtgtaacctgtaaggaagaaaaagtccttcgtaac
aataaaaactttactactgtagatatccagaagaatggtgttaaatttaccaacagcaaa
ttgacttctttaaatgaagaatataccaaaaataaaacagaatatgaagaagcccaggat
gccattgttaaagaaattgtcaatatttcttcaggctatgtagaaccaatgcaaacactc
aatgatgtgttagctcagctagatgccgttgtcagttttgctcatgtgtcaaatggagca
cctgttccatatgtacgaccagtcattttggagaaaggacaaggaagaatcattttgaaa
gcatccaggcatgcttgtgttgaagttcaggatgaagttgcgtttattcctaatgatgta
tactttgaaaaaaataaacagatgttccacatcattactggccccaatatgggaggtaaa
tcaacatatattcgacaaactggggtgatagtacttatggcccaaattgggtgctttgtg
ccatgtgagtcagcggaagtgtccattgtggactgcatcttggcccgagtaggggctggt
gacagtcaattgaaaggagtctctacattcatggctgaaatgttggaaactgcttctatc
ctcaggtctgcaaccaaagattcattaataataatagatgaattgggaagaggaacttct
acctatgatggatttgggttagcatgggctatatcagaatatattgcaacgaagatcggt
gctttttgcatgtttgcaacccattttcatgaacttactgccttggccaatcagatacca
actgttaataatctacatgtcacagcactcaccactgaagagaccttaactatgctttat
caagtgaagaaaggtgtctgcgatcaaagttttgggattcatgttgcagagcttgctaat
ttccctaagcatgtaatagagtgtgctaaacagaaagccttggaacttgaggagtttcaa
tatattggagaatcgcaaggatatgataacatggaaccagcaacaaagaggtgctatctg
gaaagagagcaaggtgaaaaaattattcaggagttcctgtccaaggtgaaacaaatgccc
tttactgaaatgtcagaagaaaacatcacaataaagttaaaacagctaaaagccgaggta
atagcaaagaataatagctttgtaaatgaaatcatttcacgaataaaagttactgtgtaa

DBGET integrated database retrieval system