KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044203
Entry
101044203         CDS       T04350                                 

Gene name
OLR1
Definition
(RefSeq) oxidized low-density lipoprotein receptor 1
  KO
K08763  oxidised low-density lipoprotein receptor 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04145  Phagosome
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101044203 (OLR1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101044203 (OLR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101044203 (OLR1)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:sbq04054]
    101044203 (OLR1)
   04091 Lectins [BR:sbq04091]
    101044203 (OLR1)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    101044203 (OLR1)
Pattern recognition receptors [BR:sbq04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   101044203 (OLR1)
Lectins [BR:sbq04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   101044203 (OLR1)
SSDB
Motif
Pfam: Lectin_C UL45 Ly49 UPF0242 CENP-Q AAA_15 RecC_C DUF1664 FANCI_HD2 Surp PIN_8 DUF4446 LMBR1 DUF1690 Exonuc_VII_L PI_PP_I GD_AH_C FapA
Other DBs
NCBI-GeneID: 101044203
NCBI-ProteinID: XP_003934543
UniProt: A0A2K6UX84
LinkDB
Position
Unknown
AA seq 274 aa
MTFDDLKIKTMKDHPDEKSNGKKAKGLPFLYSPWWCLVAVTLGVLCLGSVVIIIKLGVEL
SQVSDLLTQQQANLTHQKNKLEGQISARQQAEEASQESQKELKEIIETLAQKLNEKSKEQ
MELHQQNLNLQETLKRVANCSAPCPQDWIWHQENCYLFSSGSLDWKKSQENCLSLDAKLL
KINSTADLDFIVQAVSHSSFPFWIGLSRRNPRYPWLWEDGSPLMPYLFRLRGAVSQTYSL
GSCAYIQQGTVFAENCALVAFRICQKKANLLRAQ
NT seq 825 nt   +upstreamnt  +downstreamnt
atgacttttgatgacctaaagatcaagactatgaaggaccaccctgatgagaagtcaaat
ggaaaaaaagctaaaggtcttccctttctttattctccatggtggtgcctggttgctgtg
actctaggggtcctttgcctgggatcggtggtgatcattataaagctgggtgtggaatta
tcccaggtatcggacctcctaacacaacagcaagcaaatctaactcaccagaaaaataaa
ctggagggacagatctcagccaggcaacaggcagaagaagcttcacaggaatcacaaaaa
gaactcaaggaaattattgaaaccctcgcccagaagttgaatgagaaatccaaagagcaa
atggaacttcaccaacagaatctgaatctccaagaaacactaaagagagtagcaaattgt
tcagctccttgtcctcaagactggatctggcatcaagaaaactgttacctattttcctcg
ggctcacttgactggaaaaagagccaagagaactgtttatctttggatgccaagttgctg
aaaattaatagtacagcggatctggacttcatcgtgcaagcagtttcccattccagtttc
ccattctggattgggctgtctcggaggaacccccgctacccgtggctctgggaggacggt
tctcctctgatgccctacttatttagactccgaggtgctgtttcccagacatactcttta
ggttcctgcgcatatatacaacaaggaactgtttttgcggaaaactgcgctttggttgcc
ttcagaatatgtcagaagaaggcaaatctactaagagcacagtga

DBGET integrated database retrieval system