KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044226Help
Entry
101044226         CDS       T04350                                 

Gene name
LCT
Definition
(RefSeq) lactase-phlorizin hydrolase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00052  Galactose metabolism
sbq01100  Metabolic pathways
sbq04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:sbq00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101044226 (LCT)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    101044226 (LCT)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     101044226 (LCT)
    3.2.1.108  lactase
     101044226 (LCT)
Chaperones and folding catalysts [BR:sbq03110]
 Intramolecular chaperones
  Others
   101044226 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 101044226
NCBI-ProteinID: XP_003922057
UniProt: A0A2K6V821
LinkDB All DBs
Position
Unknown
AA seq 1926 aa AA seqDB search
MELLWHVVFIVLLSFPCWGLDWESDRNFISAAGPLTNDLLNNLSGPLGDQSSNFVAGDQD
IYVCHQPLPTFLPEYFSSLHAGKITHYKVFLSWAQLLPVGSTQNPDEKTVQCYRRFLEAL
KTAQLQPMVVLHHQTLPASILQRTEVFSDLFADYAAFAFHSFGDLVGIWFTFSDLEEVIK
KLPHQKSRASQLQTLSDAHRKAYEIYHENHASQGGKLSVVLRAEDIPELLLEPPISALAQ
DAVDFLSLDLSYECQNEASLRQKLSKLQTIEPKVKVLIFNLKLSGCPSTMKSPARLFSLF
EAINKDQVLTIGFDINEFLSCSSSSKKSTSCSLTGSLALQPDQQEDRETTRSSLASAYQR
AWEAFANQSRAERDTFLQDVFPEGFLWGTSTGAFNVEGGWAEGGRGPSIWDPRRPLNNTE
GQATPEVASDSYHKVVSDIALLRGLRAQVYKFSISWSRIFPMGHKSSPSLPGIAYYNKLI
DSLRDTGIEPMATLFHWDLPQALQDHGGWQNESVVDAFLDYAAFCFSTFGDRVKLWVTFH
EPWVMSYAGYGTGQHRPGISDPGVGSFKVAHLVLKAHARTWHHYNKHHRPQQQGHVGIVL
NSDWAEPLSPERPEDLRASERYLHFMLGWFAHPIFVDGDYPATLRTQIQQMNRQCPHPVA
QLPEFTEAEKQLLKGSADFLGLSHYTSRLISNAPQNTCIPSYNTIGGFSQHVSHAWPQTS
SSWIRVVPWGIRRLLKFVSLEYTRGEVPIYLAGNGMPIGESEDLFDDSLRVDYFNQYINE
VLKAIKEDSVDVRSYIARSLIDGFEGPSGYSQRFGLHHVNFNDSSKPRTPRKSAYFFTSI
IEKNGFLTNVAKRLPPPNTANLPSKVRALTFPSEVPSKAKVVWEKFSSQPKFERDLFYHG
TFRDDFLWGVSSSAYQIEGGWDADGKGPSIWDNFTHTPGSNVKDNATGDIACDSYHQLDA
DLNMLRALKVKAYHFSISWSRIFPTGRNSSINSLGVDYYNRLIDGLVASNIFPMVTLFHW
DLPQALQDIGGWENPVLIELFDSYADFCFQTFGDRVKFWMTFNEPMYLAWLGYGSGEFPP
GVKDPGWAPYRIGHAIIKAHARVYHTYDEKYRQEQKGVISLSLSTHWAEPKSLGVPRDVE
AADRMLQFSLGWFAHPIFRNGDYPDAMKWKVGNRSELQHLATSRLPSFTEEEKRFIRATA
DIFCLNTYSSRIVQYKTPRLNPPSYEDDQEMTTEEDPSWPSTAVNRAVPWGMRRLLNWIK
EEYGDIPIYITENGVGLTNPNEEDTDRIFYHKTYINEALKAYRLDGVDLRGYAAWSLMDN
FEWLNGYTVKFGLYRVDFNNTNRPRTARASARYYTEVITNNGMPLPKEDEFVYGWFPEGF
IWSAASAAYQIEGAWRADDKGLSIWDTFSHTPLKIENDAIGDVACDSYHKLAEDLVTLQN
LGVSHYRFSISWSRILPDGTTRYISEAGLNYYVRLINTLLAANIQPQVTIYHWDLPQALQ
DIGGWENETIVQRFKEYADVLFRRLGDKVKFWITLNEPFVVAYEGYGSGTKAPGISARPG
TAPYIVGHNLIKAHAEAWHLYNDVYRASQGGVISITISSDWAEPRDPSNQEDVEAARRYV
QFMGGWFAHPIFKNGDYNEVMKTRIRERSLAAGLSKSRLPEFTENEKKRINGTYDFFGFN
HYTTVLAYNLNYPTVVSSFDADRGVASIADRSWPDSGSSWLKMTPFGFRRILNWLKEEYN
DPPIYVTENGVSQREETDLNDTARIYYLRTYINEALKAVQDKVDLRGYTVWSTMDNFEWA
TGFSERFGLHFVNYSDPSLPRIPKASAKFYASVVRCNGFPDPATGPHACLQQPDAGPTVS
PVREQEVQFLGLMLSTAAAQTALYILFSLVLLGVCGIAFLLYKYCKRSKQEKTQPSQLEL
SPVSSF
NT seq 5781 nt NT seq  +upstreamnt  +downstreamnt
atggagctgttgtggcatgtagtctttattgtcctgctaagttttccatgctgggggttg
gactgggagtctgatagaaatttcatttccgctgctggtcctttaaccaatgacttgctg
aacaacctgagtggtcccctaggagaccagagttctaactttgtagcaggagaccaagac
atttatgtttgtcaccagccactgcccactttcctgccagaatacttcagcagtcttcat
gccggtaagatcactcattataaggtatttctgtcatgggcacagctcctcccagtggga
agcacccagaatcccgacgaaaaaacagtgcagtgctatcggcgattcctggaggccctc
aagaccgcacagcttcagcccatggttgtcctgcaccaccagaccctccctgccagcatc
ctccagagaactgaagtcttcagtgacctctttgctgactatgctgcattcgcctttcac
tccttcggggacctagttgggatctggttcacctttagtgacctggaggaagtgatcaag
aagcttccccaccagaaatcaagagcatcacagctccagaccctcagtgatgcccacaga
aaagcctatgagatttaccatgaaaaccatgcttctcaaggtggaaagctctctgttgtt
ctacgagctgaagatatcccggagcttctgctagaaccgcccatatctgcacttgcccag
gatgcggttgatttcctctctcttgatttgtcttatgaatgccaaaatgaggcaagtctg
cggcagaagctgagtaaattgcagactattgagccaaaagtgaaagttttgatcttcaac
ctaaaactctcaggctgcccctccaccatgaagagcccagccaggcttttcagccttttc
gaagccataaataaagaccaagtgctcaccattgggtttgatattaatgagtttctgagt
tgttcatcaagttccaagaaaagcacatcttgttctctgactggcagcctggcccttcag
cctgaccagcaggaggaccgcgagaccacacgttcctctcttgcctcggcctatcagaga
gcctgggaagcatttgccaatcagtccagggcagaaagggacaccttcctgcaggacgtt
ttccctgaaggcttcctctggggcacctccacgggagcctttaacgtggaaggaggctgg
gctgagggcgggagaggaccgagcatctgggatccacgcaggcccctgaacaacactgag
ggccaagcgacaccagaggtggccagtgacagctaccacaaggtcgtctctgacatcgcc
ctgcttcgtggcctccgggctcaggtgtacaagttctccatctcctggtcccggatcttc
cccatggggcacaagagcagccccagcctcccaggcattgcctactacaacaagctgatt
gacagtctgcgggacacgggcatcgagcccatggccacgctgttccactgggacctgcct
caggccctgcaggatcatggcggatggcagaatgagagtgtggtggatgccttcctggac
tatgcagccttctgcttctccacgtttggggaccgtgtgaagctgtgggtgaccttccat
gagccgtgggtgatgagctatgcaggctatggcactggtcaacaccgtcctggcatctct
gacccaggagtgggctcttttaaggtggctcacttggtcctcaaggctcatgccagaact
tggcaccactacaataagcaccatcgcccacagcagcaggggcatgtgggcattgtgctg
aactcagactgggcagaacccctgtctccagagaggcctgaggacctgagagcctctgag
cgctacttgcacttcatgctgggctggtttgcacaccccatctttgtggatggagactac
ccagccaccctgaggacccagattcaacagatgaacagacagtgcccccatcctgtggca
caactccccgagttcacagaagcagagaagcagctcctgaaaggctctgctgattttctg
ggtctgtctcattacacctcccgccttatcagcaatgccccacaaaacacctgcatccct
agctacaataccattggaggcttctcccaacacgtgagccatgcatggccccagacctca
tcctcttggattcgtgtggtgccctgggggataaggaggctgttgaagtttgtatccctg
gaatatacaagaggagaagttccaatatacctggccgggaatggcatgcccataggggaa
agtgaagatctctttgatgattccttgagagtagactacttcaatcaatatatcaatgaa
gtgctcaaggctatcaaggaagactccgtggatgttcgttcttacattgctcgttccctc
attgacggctttgaaggcccctctggttacagccagaggtttggcctgcaccatgtcaac
ttcaacgacagcagcaagccaaggactcccaggaaatctgcctactttttcaccagcatc
atagaaaagaacggtttcctcaccaacgtggcaaaaagactgccaccacctaatacagca
aacctcccctccaaagtcagagccttaacttttccatctgaggtaccctccaaggctaaa
gtggtttgggaaaagttctccagccaacccaagtttgaaagagatttgttctaccatggg
acgtttcgggatgactttctgtggggtgtgtcctcttctgcttatcagattgaaggaggg
tgggatgccgacggcaaaggccccagcatctgggataactttacccacacaccagggagc
aatgtgaaagacaatgccactggagacattgcctgtgacagctatcaccagctggatgcc
gatctgaatatgctccgagctttgaaggtgaaggcctaccacttttctatctcctggtct
cggattttcccaactgggagaaacagctctatcaatagtcttggggttgattattacaat
aggctgattgatggcttggtggcaagcaacatctttcccatggtgacattgttccattgg
gacctgccccaggccctccaggatattggaggctgggagaatcctgttttgattgagttg
tttgacagctatgcagacttttgtttccagacctttggtgacagagtcaagttctggatg
acttttaatgagcccatgtatctggcatggctgggttatggctcaggggagtttccccca
ggggtgaaggacccaggctgggcaccatataggataggacacgccattatcaaagcccat
gctagagtctatcacacgtacgatgagaaatacaggcaggagcagaagggggtcatctct
ctgagcctcagtacacactgggcagaacccaagtcactgggggtccccagagatgtggaa
gctgctgaccgaatgctgcagttctctctgggctggtttgcacaccccatttttagaaac
ggagactatcctgatgccatgaaatggaaagtggggaaccggagtgaactgcaacactta
gccacctcccgcttgccaagtttcactgaggaagagaagaggttcattagggcaacggct
gacatcttctgcctcaacacctactcctccagaattgtgcagtacaaaacacccaggcta
aacccaccgtcctatgaagatgaccaggagatgaccacggaggaggacccttcatggcct
tccactgcagtgaacagagctgtgccctggggtatgcgaaggctgctgaactggatcaag
gaagagtatggtgacatccccatttacatcaccgaaaatggagtggggttgaccaatcca
aacgaggaggatactgataggatattttaccacaaaacctacatcaatgaggctttgaaa
gcctacaggctcgatggtgtagaccttcgaggatatgctgcctggtctctgatggacaac
tttgagtggctgaatggctacacagtcaagtttggactgtaccgtgtcgatttcaacaac
acaaacaggcctcgcacagcaagagcctctgccaggtactacacagaggtgattaccaac
aacggcatgccactgcccaaggaggatgagtttgtgtatggatggtttcctgagggtttc
atctggagtgcggcttctgctgcgtatcagatcgaaggtgcgtggagagcagatgacaaa
ggactcagtatttgggacacattttctcacacaccactgaagattgagaatgatgccatt
ggagacgtggcctgtgacagttatcacaagcttgctgaggatctggtcaccctgcagaac
ttgggtgtgtcccactaccgtttttccatctcctggtctcgtatcctccctgatggaacc
accaggtacatcagtgaagcgggcctgaactactatgtgcggctcatcaacacactgctg
gccgccaacatccagccccaggtgaccatttaccactgggacctaccgcaggcactccag
gatataggaggctgggagaatgagaccattgtgcagcggtttaaggagtatgcagatgtg
ctcttccggaggctgggagacaaggtgaagttttggatcacgctgaatgagccctttgtc
gttgcttacgagggctatggctccggaacaaaagctccaggaatctccgctaggcctggc
actgccccctacattgttggccacaacctaataaaagctcatgctgaggcctggcatttg
tacaacgatgtgtaccgcgccagtcaaggtggcgtgatttccatcaccatcagcagtgac
tgggctgaacccagagatccgtctaaccaggaggatgtggaggcagccaggagatatgtt
cagttcatgggaggctggtttgcacatcctattttcaagaatggagattacaatgaggtg
atgaagacacggatccgtgaaaggagcttggctgcaggcctcagcaagtctcggctacca
gaatttacagagaatgagaagaagaggatcaatggcacctatgacttttttggtttcaat
cactacaccactgtcctggcctacaacctcaactatcccactgtcgtctcttcttttgat
gcagacagaggagttgcctctatcgcagatcgctcgtggccagactctggctcctcctgg
ctgaagatgacgccatttggcttcaggaggatcctgaactggttaaaagaggagtacaat
gaccctccaatttatgtcacggagaatggagtgtcccaacgggaagaaacagacctcaat
gacactgcgaggatctactaccttcggacttacatcaatgaagccctcaaagctgtgcag
gacaaggtggaccttcgaggatacacagtttggagtacgatggacaattttgagtgggcc
acaggcttttcagagagatttggtctgcattttgtgaactacagtgacccttctctgcca
aggatccccaaagcgtcagccaagttctatgcttctgtggtccgatgcaatggcttccct
gaccctgcgacagggcctcacgcttgtctccaacagccagatgctggacccactgtcagc
cccgtgagagagcaggaggtgcagttcctggggctaatgctcagcaccgcagcagcacag
acagctttgtatattctcttttctcttgtgcttcttggagtctgtggcatcgcatttctg
ttatacaagtactgcaagcgctccaagcaagagaaaacacaaccaagccaactggaattg
agcccagtttcttcattctga

DBGET integrated database retrieval system