KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044233
Entry
101044233         CDS       T04350                                 

Gene name
DDX58
Definition
(RefSeq) probable ATP-dependent RNA helicase DDX58
  KO
K12646  ATP-dependent RNA helicase DDX58 [EC:3.6.4.13]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04064  NF-kappa B signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05164  Influenza A
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101044233 (DDX58)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    101044233 (DDX58)
   04623 Cytosolic DNA-sensing pathway
    101044233 (DDX58)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    101044233 (DDX58)
   05160 Hepatitis C
    101044233 (DDX58)
   05171 Coronavirus disease - COVID-19
    101044233 (DDX58)
   05164 Influenza A
    101044233 (DDX58)
   05162 Measles
    101044233 (DDX58)
   05168 Herpes simplex virus 1 infection
    101044233 (DDX58)
   05169 Epstein-Barr virus infection
    101044233 (DDX58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:sbq04054]
    101044233 (DDX58)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     101044233 (DDX58)
Pattern recognition receptors [BR:sbq04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   101044233 (DDX58)
SSDB
Motif
Pfam: CARD_2 RIG-I_C RIG-I_C-RD DEAD ResIII Helicase_C AAA_22 AAA_25 Syntaxin_2 PhoH Peptidase_S51
Other DBs
NCBI-GeneID: 101044233
NCBI-ProteinID: XP_003939778
UniProt: A0A2K6U9E4
LinkDB
Position
Unknown
AA seq 937 aa
MTAEQRRSLGAFRDYIRKTLDPTYILSYMAPWIREEEVQYIQAEKNNKGPMEAATLFLKI
LLELQEEGWFRGFLDALDHAGYSGLYEAIESWDFQKIEKLEEYRLLLKRLQPEFKSRIIP
IDILPDLSECLINQECEEITQICSTKGMMAGAEKLVECLLRSDKENWPKTLKFALEKERN
KFSELWIIEKGIKDVETEDLEEKMETSDIQIFYQEDPECQNLSENSCLPSEVSDTDLYSP
FKLRSYQLELALPAKKGKNTIICAPTGCGKTFVALLICEHHLKKFPQGQKGKVVFFANQI
PVYEQQKSVFSKYFERLGYRVTGISGATADNAPVKQMVENNDIIILTPQILVNNLKNGTI
PSLSVFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKST
DEALDYICKLCASLDASVIATVRDNLEELEQVVYKPQKFFRKVESRINDKFKCIIAQLMR
ETESLAKRICKDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFL
YTSHLRKYNDALIINEDARMKDALHYLKDFFSNVRAAGFDETEQDLTQRFEEKLQELESV
SRDPSNENPKLEDLCFILREEYHLNPETITILFVKTRALVDALKNWIEGNPQLSFLKPGI
LTGRSKTNQNTGMTLPAQKCILDSFKAHGDHNILIATSVADEGIDIAQCNLVILYEYVGN
VIKMIQTRGRGRARGSKCFLLTSSAAVIEKENINMYKETMMNDSILRLQTWDEAEFKEKI
LHIQIHEKFIRDSQEKTKPVPDKENKKLLCRKCKAFACYTADIRVIEESHYTVLGDAFKE
CFVSRPHPKPTQFSNFHKRAKIFCARRDCSHDWGIHVKYKTFEIPVIKMESFVVEDIATG
VQTLYSKWKDFHFEKIPFDAAEMSTISEPQPSASGNE
NT seq 2814 nt   +upstreamnt  +downstreamnt
atgaccgccgagcagcggcgcagcctgggcgccttccgcgattacatccggaagaccctg
gaccctacctacatcctgagctacatggccccctggattagggaggaagaggtgcagtac
attcaggctgagaaaaacaacaagggcccaatggaggctgccacactttttctcaagatc
ctgttggagctccaggaggaaggctggttccgtggctttttggatgccctagaccacgca
ggttattctggactttatgaagccattgaaagttgggatttccaaaaaattgaaaagttg
gaggagtatagattacttttaaaacgtttacaaccagaatttaaaagtagaattattcca
atagatatccttcctgatctatctgaatgtttaattaatcaggagtgtgaagaaattaca
cagatttgctccactaagggaatgatggcaggtgcagagaaattggtggaatgccttctc
agatcagacaaggagaactggcccaaaactttgaaatttgctttggagaaagaaaggaac
aaattcagtgagctgtggattatagagaaaggtataaaagatgtggaaacagaagatctt
gaggagaagatggaaacttctgacatacagattttctaccaagaagatccagaatgccag
aaccttagtgagaattcatgtctgccttcagaagtgtctgatacagacttgtacagccca
tttaaactaagaagttaccaattagagcttgctttgcctgccaagaaaggaaaaaacaca
ataatatgtgctcccacaggttgtggaaaaacctttgttgcactccttatatgtgaacat
catcttaaaaaattccctcaaggacaaaaggggaaagttgtcttttttgctaatcagatc
ccagtgtatgaacagcagaaatctgtattctcaaaatactttgaaagacttgggtataga
gttacaggcatttctggagcaacagctgataatgccccagtgaaacagatggttgagaac
aacgacatcatcattttaactccacagattcttgtgaacaaccttaaaaatggaacgatt
ccatcactgtccgtcttcactttgatgatatttgatgaatgccacaacactagtaaacaa
catccatacaatatgatcatgttcaattatctagatcagaaacttggaggatcttcaggc
ccactgccccaggtcattgggctgactgcctcggttggtgttggggatgccaaaagcaca
gatgaagctttggattatatctgcaagctgtgtgcttctcttgatgcgtcagtgatagca
acagtccgagacaacctggaggaactggagcaagttgtttataagccccagaagtttttc
aggaaagtggaatcacggattaacgacaaatttaaatgcatcatagctcagctgatgagg
gagacagagagtctggcaaagagaatctgcaaagacctcgaaaacttatctcaaattcaa
aatagggaatttggaacacaaaaatatgaacaatggattgttacagttcagaaagcatgc
atggtgttccagatgccagacaaagatgaggagagcaggatttgtaaagccctgtttttg
tacacttcacatttgcggaaatataatgatgccctcattattaatgaggacgcacgaatg
aaggatgctctgcattacttgaaagacttcttcagcaatgtccgggcagcaggattcgat
gagactgaacaagatcttactcagagatttgaagaaaagctgcaggaactcgaaagtgtt
tccagggatcccagcaatgagaaccctaaactcgaagacctttgcttcatcttacgagaa
gagtaccacttaaacccagagacaataacaattctctttgtgaaaaccagagcacttgtg
gatgctttaaaaaattggattgaaggaaatcctcaactcagttttctaaaacctggcata
ttgactggacgtagcaaaacaaatcagaacacaggaatgactctcccagcacagaagtgt
atattggattcatttaaagcccacggagatcacaatattctgattgccacctcagttgct
gatgaaggcattgacattgctcagtgcaatcttgtcatcctgtatgagtatgtgggtaat
gtcatcaaaatgatccaaaccagaggtagaggaagagcaagaggtagcaagtgcttcctt
ctgaccagtagtgctgctgtaattgaaaaggagaacataaacatgtacaaagaaacaatg
atgaatgactccattttacgccttcagacatgggatgaagcagaatttaaggaaaagatt
ctgcatatacagattcatgaaaaattcatcagagatagtcaagagaaaacaaaacctgta
cctgataaggaaaataaaaaactgctttgcagaaagtgcaaagcctttgcatgttacaca
gctgacataagagtgatagaggaatcccattacactgtgcttggtgatgcttttaaggaa
tgctttgtgagtagaccacatcctaaaccaacacagttttcaaattttcataaaagagca
aagatattctgtgcccgacgggactgcagccatgactggggaatccatgtgaagtacaag
acatttgagattccagtaataaaaatggaaagttttgtggtggaggacattgcaactgga
gttcagacactgtattcaaagtggaaggactttcattttgagaagataccatttgatgca
gcagaaatgtccacgatatcagagcctcaaccttcagcttccgggaatgagtaa

DBGET integrated database retrieval system