KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044303Help
Entry
101044303         CDS       T04350                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00020  Citrate cycle (TCA cycle)
sbq00190  Oxidative phosphorylation
sbq01100  Metabolic pathways
sbq01200  Carbon metabolism
sbq04714  Thermogenesis
sbq04932  Non-alcoholic fatty liver disease (NAFLD)
sbq05010  Alzheimer disease
sbq05012  Parkinson disease
sbq05016  Huntington disease
Module
sbq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sbq_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101044303 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101044303 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101044303 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    101044303 (SDHB)
   05012 Parkinson disease
    101044303 (SDHB)
   05016 Huntington disease
    101044303 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101044303 (SDHB)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101044303 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-GeneID: 101044303
NCBI-ProteinID: XP_010343895
LinkDB All DBs
Position
Unknown
AA seq 270 aa AA seqDB search
MAAAKLPGLPAACKACRGAQTTAAAAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGP
MVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPL
PHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQGGKQQYLQSIEDREKLDGLYECILCA
CCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCT
RTCPKGLNPGKAIAEIKKMMATYKEKKASA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgccaagttaccaggactccccgccgcctgcaaggcctgtcgaggagcccag
acaactgcagccgcagctccccgtatcaagaaatttgccatctatcgatgggacccagac
aaggctggagacaaacctcatatgcagacttatgaagttgaccttaataaatgtggcccc
atggtattggatgctttaatcaagattaagaatgaaattgactctactttgaccttccga
agatcatgcagagaaggcatctgtggctcttgtgcaatgaacatcaatggaggcaacact
ctagcctgcacccgaaggattgacacaaacctcgataaagtctcaaaaatctaccctctt
ccgcatatgtatgtgataaaggatcttgttcctgatttgagcaacttctatgcacagtac
aaatccattgagccttatttgaagaagaaggatgaatctcagggaggcaagcagcagtat
ctgcagtccatagaagaccgtgagaaactggatgggctctacgagtgcattctctgtgcc
tgctgtagcaccagctgccctagctactggtggaacggagacaagtatctggggcctgca
gttcttatgcaggcctatcgctggatgattgactccagagatgacttcacagaggagcgc
ctggccaagctgcaggacccgttctctctgtaccgctgccacaccatcatgaactgcaca
aggacctgtcccaagggtctgaatccagggaaggctattgcagaaatcaagaaaatgatg
gcaacctataaggagaagaaagcttcagcttaa

DBGET integrated database retrieval system