KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044335Help
Entry
101044335         CDS       T04350                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00010  Glycolysis / Gluconeogenesis
sbq00030  Pentose phosphate pathway
sbq00051  Fructose and mannose metabolism
sbq00052  Galactose metabolism
sbq01100  Metabolic pathways
sbq01200  Carbon metabolism
sbq01230  Biosynthesis of amino acids
sbq03018  RNA degradation
sbq04152  AMPK signaling pathway
sbq05230  Central carbon metabolism in cancer
Module
sbq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101044335 (PFKP)
   00030 Pentose phosphate pathway
    101044335 (PFKP)
   00051 Fructose and mannose metabolism
    101044335 (PFKP)
   00052 Galactose metabolism
    101044335 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101044335 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101044335 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    101044335 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sbq01009]
    101044335 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sbq03019]
    101044335 (PFKP)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101044335 (PFKP)
Protein phosphatases and associated proteins [BR:sbq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101044335 (PFKP)
Messenger RNA biogenesis [BR:sbq03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101044335 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 101044335
NCBI-ProteinID: XP_003939112
UniProt: A0A2K6U5N7
LinkDB All DBs
Position
Unknown
AA seq 784 aa AA seqDB search
MDADHSQGPKGSLRKLLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGSNIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAACNLVQRGIT
NLCVIGGDGSLTGANLFRKEWSGLLEELAKNGHIEKEAVQRYAYLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLSGNHAVRLPLMEC
VQMTQDVQKAMDERRFQDAVRLRGKSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGA
PAAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTK
RALPGKCLEEIAMQMRMHCINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAKLKEARGRGKKFTTDDSVCVL
GISKRNVIFQPVAELKKETDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQ
PWSV
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggacgcggaccactcccagggccccaagggctccttgcggaagctcctggagcacctc
tccggggccggcaaggctatcggcgtgctgaccagcggcggggatgcccaaggcatgaac
gctgcggtgcgcgccgtagtgcgcatgggtatctacgtgggggccaaggtgtacttcatc
tacgagggctaccagggcatggtggacggaggctcgaacatcgcggaggcggactgggag
agcgtctccagcatattgcaagtgggcgggacgatcatcggcagcgcgcggtgccaggcc
ttccgcacgagggagggccggctgaaggccgcctgcaacctggtgcagcgtggcatcacc
aacctgtgtgtgatcggcggggacgggagcctcaccggggccaacctcttccggaaggag
tggagcgggctgctggaggagctggccaagaacggccacattgagaaggaagccgtgcag
aggtatgcctacctcaacgtggtgggcatggtgggctccatcgacaatgacttctgtggc
accgacatgaccattggcacagactcggccctgcacaggatcatcgaggtggtggacgcc
atcatgaccacagcccagagccaccagaggaccttcgttctggaggtgatggggcgacac
tgtgggtacctggccctggtgagcgccttggcgtgcggtgcagactgggtgttccttcca
gaatctccgccagaggaaggctgggaggagcagatgtgtgtgaaactctccgagaaccgt
gcccggaaaaaaaggctgaatattattattgtggctgaaggagcaattgacacccaaaat
aaacccattacctctgagaaaatcaaagagctcgtcgtcacgcagctgggctacgacaca
cgcgtgaccatcctcgggcacgtgcagagaggagggaccccttcggcgttcgacaggatc
ttggccagccgcatgggagtggaggcggtcatcgccctgctggaggccacccccgacacg
ccagcttgcgtcgtgtctctcagcgggaaccacgctgtgcgcctgccgctgatggagtgc
gtgcagatgactcaggatgtgcagaaggcgatggatgagaggaggtttcaggacgcggtt
cgactccggggaaagagctttgcgggcaacctgaacacctacaagcgacttgccatcaag
ctgccagatgatcagatcccaaagaccaattgcaacgtggctgtcatcaacgtgggggcc
cccgcggctggaatgaacgccgccgtgcgctcggccgtgcgcgtgggcatcgccgacggc
cacaggatgcttgccatctacgacggctttgacggctttgccaaaggccagatcaaagaa
atcggctggacggatgtcgggggctggactggccagggaggctccattctcggcactaaa
cgcgctctcccggggaagtgcttggaggagatcgccatgcagatgcgcatgcactgcatc
aacgcgctgctgatcatcgggggattcgaggcctacctgggactcctggagctgtcagcc
gcccgggagaagcacgaggaattctgtgtccccatggtcatggttcccgccactgtgtcc
aacaatgtgcccggttccgatttcagcattggggcagacacagctctgaatactatcacc
gacacatgtgaccgcatcaagcagtcggccagcgggaccaagcggcgcgtcttcatcatc
gagactatggggggctactgcggctacctggccaacatgggagggctggcggccggcgcc
gacgccgcctacattttcgaggagcccttcgacatcagggacctgcagtccaacgtggag
cacctgacggagaaaatgaagaccaccatccagaggggccttgtcctcagaaatgagagc
tgcagcgaaaactacaccaccgacttcatttaccagctctattcggaagagggcaagggg
gtgttcgactgcaggaagaatgtgctgggtcacatgcagcagggtggagcaccctctcca
tttgatagaaactttggaaccaaaatctctgccagagccatggagtggatcactgcgaag
ctcaaggaggcccggggcagagggaaaaaatttaccaccgatgattctgtttgcgtgctg
ggaataagcaaaagaaacgtcatttttcagcctgtggcagagctgaagaaggaaacagat
tttgagcacaggattcccaaagaacagtggtggctgaagcttcggcccctcatgaagatc
ctggccaagtacaaggcgagctacgacgtgtcggactcgggccagctggagcacgtgcag
ccctggagcgtctga

DBGET integrated database retrieval system