KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044613
Entry
101044613         CDS       T04350                                 

Gene name
UCP1
Definition
(RefSeq) mitochondrial brown fat uncoupling protein 1
  KO
K08769  solute carrier family 25 (mitochondrial uncoupling protein), member 7
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04371  Apelin signaling pathway
sbq04714  Thermogenesis
sbq05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101044613 (UCP1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101044613 (UCP1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101044613 (UCP1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    101044613 (UCP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbq02000]
    101044613 (UCP1)
Transporters [BR:sbq02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   101044613 (UCP1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 101044613
NCBI-ProteinID: XP_003928073
UniProt: A0A2K6TIY6
LinkDB
Position
Unknown
AA seq 307 aa
MGGLTASDVHPTLGVQLFSAGVAACLADVITFPLDTAKVRLQVQGECPTSSGIRYKGVLG
TITTLVKTEGRVKLYSGLPAGLQRQIGSTSLRIGLYDTVQEYLTSGKETTPSLGSKILAG
LATGGVAVFIGQPTEVAKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGVTGLWKGTIPN
LTRSVIINCTELVTYDLMKEAFVKNDILADDVPCHLVSALIAGFCATAMSSPVDVVKTRF
INSPPGQYKSVPNCAMKMFTKEGPTAFFKGLIPSFLRLGSWNVIMFVCFEKLKRELSKSR
QTVDCTT
NT seq 924 nt   +upstreamnt  +downstreamnt
atggggggcctgacagcctcggacgtgcacccgaccctgggggtccagctcttctccgct
ggagtggcagcgtgcttggcggacgtgatcaccttcccgctggacacggccaaagtccgg
ctccaggtccaaggcgaatgcccgacgtccagtggtattaggtataaaggtgtcctggga
acaatcaccactctggtaaaaacagaagggcgcgtgaaactctacagcgggctgcctgcc
ggccttcagagacaaatcggctccacctctctcaggattggcctttatgacacggtccag
gagtacctcacctcaggaaaagaaacaacacctagtttaggaagcaagatcttagctggt
ctagcgactggaggagtggcagtattcatcgggcaacccacagaggtcgctaaagtcaga
cttcaagcacagagccatctccacggtatcaaacctcgctacaccgggacttacaacgcc
tacagaataatagcaacaaccgaaggcgtgacgggtctttggaaagggactattcctaat
ctgacaagaagcgtcatcatcaattgtacagagctagtaacgtatgatctaatgaaggag
gcctttgtgaaaaatgacatattagcagatgacgtcccctgccacttggtgtcagctctg
atagctggattttgtgcaacagctatgtcctccccagtggatgtggtcaaaaccagattt
attaattctccaccagggcagtacaaaagtgtgcccaactgcgcaatgaaaatgttcact
aaggagggaccaacggcttttttcaaggggttgataccttccttcttgcgactcggatcc
tggaacgtcattatgtttgtgtgctttgaaaaactgaagcgagaattgtccaagtcaagg
cagactgtggactgtaccacataa

DBGET integrated database retrieval system