KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045005
Entry
101045005         CDS       T04350                                 

Gene name
ELK1
Definition
(RefSeq) ETS domain-containing protein Elk-1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04510  Focal adhesion
sbq04910  Insulin signaling pathway
sbq04912  GnRH signaling pathway
sbq04921  Oxytocin signaling pathway
sbq05140  Leishmaniasis
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05213  Endometrial cancer
sbq05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101045005 (ELK1)
   04012 ErbB signaling pathway
    101045005 (ELK1)
   04014 Ras signaling pathway
    101045005 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101045005 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101045005 (ELK1)
   04912 GnRH signaling pathway
    101045005 (ELK1)
   04921 Oxytocin signaling pathway
    101045005 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101045005 (ELK1)
   05205 Proteoglycans in cancer
    101045005 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101045005 (ELK1)
   05213 Endometrial cancer
    101045005 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101045005 (ELK1)
   05161 Hepatitis B
    101045005 (ELK1)
   05163 Human cytomegalovirus infection
    101045005 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101045005 (ELK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101045005 (ELK1)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    101045005 (ELK1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 101045005
NCBI-ProteinID: XP_003939570
UniProt: A0A2K6TMW1
LinkDB
Position
Unknown
AA seq 428 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCLPQPEVSVNSAVANVAPAAIH
ATPGDTASGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVV
LPSAAPAGAAAPPSGSRSTSPAPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGL
GRPLPPEVKVEGPKEELEVVGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGP
VASSPEVSQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGTGSGLQAPGPALTPSLLPTH
TLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVV
LSPGPQKP
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggacccgtctgtgacgctgtggcagtttctgctgcagctgctgagagaacaaggcaat
ggccacatcatctcctggacttcacgggatggtggtgaattcaagctggtggatgcagag
gaggtggcccggctgtgggggctacgcaagaacaagaccaacatgaattacgacaagctc
agccgggccttgcggtactactatgacaagaacatcatccgcaaggtgagcggccagaag
ttcgtctacaagtttgtgtcctatcctgaagtcgcagggtgctccactgaggactgcctg
ccccagccagaggtgtctgttaattccgccgtggcaaatgtggcccctgctgctatacat
gccaccccaggggacactgcctcgggaaagccaggcactcccaagggtgcaggaatggca
ggcccaggcggtttggcacgcagcagccggaacgagtacatgcgctccggcctctattcc
accttcaccatccagtccctgcagccgcagccaccccctcatcctcggcctgctgtggtg
ctccccagcgcagctcctgcaggagcagcagcgcccccctcagggagcaggagcaccagt
ccagcccccttggaggcctgcttggaggctgaggaggccggcttgcctctgcaggtcatc
ctgaccccgcccgaggccccaaacctgaaatccgaagagctgaatgtggagccgggtttg
ggccggcctttacccccagaagtgaaagtggaagggcccaaggaagagttggaagttgtc
ggggagagagggtttgtgccagaaaccaccaaggcagagccagaagtccctcctcaggag
ggcgtgccagcccggctgcccgcggtcgttatggacaccgcagggcaggcaggcggcccc
gtggcttccagcccggaggtctcccagccgcagaaaggccggaagccccgggatctagag
cttccactcagcccgagcctgctgggtgggccgggacctgaacgaactccaggatccgga
actggctccggcctccaggcaccagggccagcgctgaccccgtctctgcttcctacgcat
acattgaccccggtgctgctgacacccagctcgctgcctcccagcattcacttctggagc
accctgagtcccattgcgcctcgcagcccagccaagctctccttccagtttccatccagt
ggcagcgcccaggtgcacatcccttccatcagcgtggatggcctctcgacccccgtggtg
ctctccccagggccccagaagccatga

DBGET integrated database retrieval system