KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045022
Entry
101045022         CDS       T04350                                 

Gene name
LRP5
Definition
(RefSeq) low-density lipoprotein receptor-related protein 5
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04150  mTOR signaling pathway
sbq04310  Wnt signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05200  Pathways in cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101045022 (LRP5)
   04150 mTOR signaling pathway
    101045022 (LRP5)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    101045022 (LRP5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101045022 (LRP5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101045022 (LRP5)
   05226 Gastric cancer
    101045022 (LRP5)
   05224 Breast cancer
    101045022 (LRP5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101045022 (LRP5)
   05022 Pathways of neurodegeneration - multiple diseases
    101045022 (LRP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101045022 (LRP5)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    101045022 (LRP5)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL Insulin_TMD DUF5653
Other DBs
NCBI-GeneID: 101045022
NCBI-ProteinID: XP_010350223
UniProt: A0A2K6S508
LinkDB
Position
Unknown
AA seq 1648 aa
MALPPREPRGRGFPGGLNTCQVPGRPRTPRVAAGAPDGAPPRVGCAGRWGGRLVPQWYTP
VGRASPLLLFANRRDVRLVDAGRVKLETTVVVSGLEDAAAVDFQFSKGAVYWTDVSEEAI
KQTYLNHTGVAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFW
QDLDQPRAIALNPAHGYMYWTDWGEMPRIERAGMDGSTRNIIVDSDIYWPNGLTIDLEEQ
KLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRT
GGKRKEILSALYSPMDIQVLSQERQPFFHTRCEEDNGGCSHLCLLSPVEPFYTCACPTGV
QLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYV
YWTDDEVRAIRRAYLDGSGAQTLINTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNG
TSRKILVSEDLDEPRAIALHPVMGLMYWTDWGENPKIECANLDGQERRVLVNASLGWPNG
LALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRS
IERVHKVKASRDIIIDQLPDLMGLKAVNVARIIGTNPCADENGGCSHLCFFTPHSTRCGC
PIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVANN
HIYWTDVSLKTISRAFLNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARL
DGQFRQVLVWRDLDNPRSLALDPTEGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRAN
DLTIDYTDQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHS
IERADKTSGQNRTLIQGHLDFVMDILVFHSSRQDGLNDCVHDNGQCGQLCLAIPGGHRCG
CASHYTLDPSGRNCSPPTTFLLFSQKSAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPL
DKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQAQNPDRQPHDLSIDIYSRTLFWTCEATNT
INVHRLSGEAMGVVLRGDRDKPRAIIVNAERGYLYFTNMQDRAAKIERAALDGTEREVLF
TTGLIRPVALVVDNALGKLFWADADLKRIESCDLSGANRLTLEDANIVQPLGLTVLGKHL
YWIDRQQQMIERVEKTTGDKRTRVQGRVTHLTGIHAVEEVSLEEFSAHPCARDNGGCSHI
CIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECD
DQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQ
CVLIKQQCDSFPDCIDGSDELMCEINKPPSDDTGAHSSAIGPVIGIILSLFVMGGIYFVC
QRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSVMSSVSLMGGR
GGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATARP
YRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAE
DSCPPSPATERSYFHLFPPPPSPCTDSS
NT seq 4947 nt   +upstreamnt  +downstreamnt
atggcgctgcccccccgtgagccgcgtggccgtgggtttccaggcggactgaacacctgc
caggtgcccgggcgaccccgaacgccccgtgtggccgccggggccccagatggcgcccct
ccccgggtcggctgcgcggggcggtggggaggcaggctcgtgcctcagtggtacacgccc
gtggggagagcctcgccactcctgctgtttgctaaccgccgggacgtacggctggtggac
gctggcagagtcaagctggagaccaccgtggtggtcagcggcctggaggatgcggccgca
gtggacttccagttctccaagggagccgtgtactggacagacgtgagcgaggaggccatc
aagcagacttacctgaaccacacgggtgtcgccgtccagaacgtggtcatctctggcctc
gtctcgcccgatggcctggcctgcgactgggtgggcaagaagctgtactggacggactcg
gagaccaaccgcatcgaggtggccaacctcaatggcacgtctcggaaggtcctcttctgg
caggaccttgaccagccgagggccatcgccttgaaccctgctcacgggtacatgtactgg
acagactggggtgagatgccccggatcgagcgggcggggatggacggcagcacccggaat
atcattgtggactcggacatttactggcccaatgggttgaccatcgacctggaggagcag
aagctctactgggctgacgccaagctcagcttcatccaccgcgccaacctggatggctcg
ttccggcagaaggtggtggagggcagcctgacgcaccccttcgccctgacgctctccggg
gacactctgtactggacagactggcagacccgctccattcatgcctgcaacaagcgcact
ggggggaagaggaaggagatcctgagcgccctctactcacccatggacatccaggtgctg
agccaggagcggcagcctttcttccacactcgctgcgaggaggacaatggtggctgctcc
cacctgtgcctgctgtccccagtggagcctttctacacatgcgcctgccccacgggcgtg
cagctgcaggacaatggcaggacgtgtaaggcaggagccgaggaggtgctgctgctggcc
cggcggacagacctgcggaggatctcgctggacacgccggacttcaccgacatcgtgctg
caggtggatgacatccggcacgccatcgccatcgactacgaccctctggagggctacgtc
tactggacggatgacgaggtgcgggccatccgcagggcgtacctggacggctcaggggcg
cagacgctgatcaacaccgagatcaacgaccccgatggcatcgcagtcgactgggtggcc
cgaaacctctactggactgacacgggcactgaccgcatcgaggtgacgcgcctcaacggc
acctcccgcaagatcctggtgtcggaggacctggatgagccccgcgccatcgcgctgcac
cctgtgatgggcctcatgtactggacagactggggagagaaccctaaaattgagtgtgcc
aacctggacgggcaggagcggcgtgtgctggtcaatgcctccctcgggtggcccaatggc
ctggccctggacctgcaggaggggaagctctactggggagacgccaagacggacaagatc
gaggtgattaatgtcgatgggacgaagaggcggaccctgctggaggacaagctcccacac
attttcgggttcacgctgctgggggacttcatctactggactgactggcagcgccgcagc
attgagcgggtgcacaaggtcaaggccagccgggacatcatcattgaccagctgcccgac
ctgatggggctcaaagctgtgaatgtggccaggatcatcggaaccaacccgtgtgctgat
gagaacggcgggtgcagtcacctgtgcttcttcacgccccactccacccggtgtggctgc
cccatcggcctggagctgctgagtgacatgaagacctgcatcgtgcccgaggccttcttg
gtcttcaccagcagagccgccatccacaggatctcccttgagaccaacaacaacgacgtg
gccatcccgctcacgggcgtcaaggaggcctcagccctggacttcgatgtggccaacaac
cacatctactggacggacgtcagcctgaagaccatcagccgcgccttcctgaatgggagc
tctgtggagcacgtggtggagtttggccttgattaccccgagggcatggctgttgactgg
atgggcaagaacctctattgggccgacaccgggaccaacaggatcgaagtggcacggttg
gacgggcagttccggcaagtcctcgtgtggagggacctggacaacccgcggtcgctggcc
ctggatcccaccgagggctacatctactggaccgagtggggcggcaagccgaggatcgtg
cgggccttcatggacgggaccaactgcatgacgctggtggacaaggtgggccgggccaac
gacctcaccattgactacactgaccaacgcctctactggaccgacctggacaccaacatg
atcgagtcgtccaacatgctgggtcaggagcgggtcgtgattgccgacgacctgcctcac
ccgtttggtctgacgcagtacagcgattatatctactggacggactggaatctgcacagc
atcgagcgggccgacaagaccagcggccagaaccgcaccctcatccagggccatctggac
ttcgtgatggacatcctggtgttccactcctcccgccaggatggcctcaacgactgtgtg
catgacaacgggcagtgcgggcagctgtgccttgccatccccggcggtcaccgctgcggc
tgcgcctcacactacaccctggaccccagcggccgcaactgcagcccacccaccaccttc
ttgctgttcagccagaaatctgccattagccgtatgatcccagacgaccagcacagcccg
gacctcatcctgcccctgcatgggctgaggaacgtcaaggccatcgactatgacccactg
gacaagttcatctactgggtggatgggcgccagaacatcaagcgagccaaggacgacggg
acccagccctttgttttgacctctctgagccaagcccaaaacccagacaggcagccccac
gacctcagcatcgacatctacagccggacgctgttctggacgtgtgaggccaccaacacc
atcaatgtccacaggctgagcggggaagccatgggggtggtgcttcgtggagaccgagac
aagcccagggccatcattgtcaacgctgagagagggtacctgtacttcaccaacatgcag
gaccgggcagccaagattgagcgcgcggccctggacggcactgagcgggaggtcctcttc
accaccggcctcatccgccccgtggccctggtggtagacaatgcgctgggcaagctgttc
tgggcggacgcggacctgaagcgcattgagagctgcgatctctcaggggccaaccgcctg
accctggaggacgccaacatcgtgcagcctctgggcctgaccgtgcttggcaagcacctc
tactggatcgaccgccagcagcagatgatcgagcgcgtggagaagaccaccggggacaag
cggactcgcgtccagggccgcgtcacccacctcacgggcatccacgcggtggaggaagtc
agcctggaggagttctcagcccacccatgtgcccgtgacaatggtggctgctcccacatc
tgtattgccaagggtgatgggacaccacggtgctcatgcccagtccacctcgtgctcctg
cagaacctgctgacctgtggagagccgcccacctgctcccctgaccagtttgcgtgtgcc
accggcgagatcgactgcatccccggggcctggcgctgcgacggctttcccgagtgcgac
gaccagagtgacgaggagggctgccccgtgtgctccgccgcccagttcccgtgcgcccgg
ggccagtgcgtggacctgcggctgcgctgcgatggcgaggccgactgtcaggaccgctcg
gacgaggccgactgtgacgccatctgcctgcccaaccagttccggtgtgccagcggccag
tgcgtcctcatcaagcagcagtgcgactccttccccgactgcatcgatggctccgacgag
ctcatgtgtgaaatcaacaagccgccctcagatgacactggagcccacagcagcgccatc
gggcctgtcatcggcatcatcctctccctctttgtcatgggtggcatctactttgtgtgc
cagcgcgtggtgtgccagcgctacgcaggggccaacgggcccttcccgcacgagtatgtc
agtgggacaccgcacgtgcccctcaatttcatagccccgggtggttcccagcatggcccc
tttacaggcatcgcatgtggcaagtccgtgatgagctctgtgagcctgatggggggccgg
ggcggggtgcccctctacgaccggaaccacgtcacaggggcctcgtccagcagctcatcc
agcacgaaggccacgctctacccgccgatcctgaacccaccgccctccccggccacggac
ccctcactgtacaacatggacatgttctactcttcaaacattccggccaccgcgagaccg
tacaggccttacatcattcgaggaatggcgcccccgacaacgccctgcagcaccgacgtg
tgtgacagcgactacagtgccagccgctggaaggccagcaagtactacctggatttgaac
tcagactcagacccctacccgcccccacccacgccccacagccagtacctgtcggcggag
gacagctgcccgccctcgcccgccaccgagaggagctacttccacctcttcccgccccct
ccgtccccctgcacggactcatcctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101054518
Entry
101054518         CDS       T04350                                 

Gene name
LRP6
Definition
(RefSeq) low-density lipoprotein receptor-related protein 6 isoform X1
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04150  mTOR signaling pathway
sbq04310  Wnt signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05200  Pathways in cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101054518 (LRP6)
   04150 mTOR signaling pathway
    101054518 (LRP6)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    101054518 (LRP6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101054518 (LRP6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101054518 (LRP6)
   05226 Gastric cancer
    101054518 (LRP6)
   05224 Breast cancer
    101054518 (LRP6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101054518 (LRP6)
   05022 Pathways of neurodegeneration - multiple diseases
    101054518 (LRP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101054518 (LRP6)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    101054518 (LRP6)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL cEGF EGF
Other DBs
NCBI-GeneID: 101054518
NCBI-ProteinID: XP_003934569
UniProt: A0A2K6SGR3
LinkDB
Position
Unknown
AA seq 1613 aa
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKQTEFNKTESVQRVVVSGILSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPTSGFMYWTDWGEVPKIERAGMDGSSRFIIVNSE
IYWPNGLTVDYEERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGEGLHEIHSNIFSPMDIHVFSQQRQPNATNPCAIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFLDGSGSQFVVTAQIAHPDGVAVDWIARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVINTDGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTVIQGHLDYVMDILVFHSSRQSGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNADNKTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLS
IDIYSRYIYWTCEAANVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGE
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEK
NCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGV
IVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYGPSRRMTSVATAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
NT seq 4842 nt   +upstreamnt  +downstreamnt
atgggggccgtcctgaggagcctcctggcctgcagcttctgtgtgcttctgagagcggcc
cctttgttgctttatgcaaacagacgggacttgcgattggttgatgctacaaatggcaaa
gagaatgctacgattgtagttggaggcttggaggatgcagctgcggtggactttgtgttt
ggtcatggcttgatatactggagtgatgtcagcgaagaagccattaaacaaacagaattt
aacaaaactgagagtgtacagcgtgttgttgtttctggaatattgtcccctgatgggctg
gcatgtgattggcttggagaaaaattgtactggacagattccgaaactaatcggattgaa
gtttctaatttagatggatctttacgaaaagttttattttggcaagagttggatcaaccc
agagctattgccttagatcctacaagtgggttcatgtactggacagactggggagaagtg
ccaaagatagaacgtgctggaatggatggttcaagtcgcttcattatagtaaacagtgaa
atttactggccaaatggactgactgtggattatgaagaacgaaagctttattgggcagat
gcaaaacttaatttcattcacaaatcaaatctggatggaacaaatcggcaggcagtggtt
aaaggttcccttccacatccttttgccttgacgttatttgaggacacattgtactggact
gactggaacacacactccattttggcttgcaacaagtatactggtgagggtctgcatgaa
atccattctaacatcttctctcccatggatatacatgtcttcagccaacagaggcaacca
aatgctacaaatccatgtgcaattgacaatggtggttgttcccatttgtgtttgatgtct
ccagtcaagcctttttatcagtgtgcttgccccactggggtcaaactcctggagaatgga
aaaacttgcaaagatggtgccactgaattactgcttttagctcgaaggacagacttgaga
cgcatttctttggatacaccagattttacagacattgttctgcagttagaagacatccgt
catgccattgccatagattacgatcctgtggaaggctacatctactggactgatgatgaa
gtgagggccatacgccgttctttcttagatggatctggcagtcagtttgtggtcactgct
cagattgcccatcctgatggtgttgccgtggactggattgcacgaaatctttattggaca
gacactggcactgatcgaatagaagtgacaaggctcaatgggaccatgaggaagatcttg
atttcagaggacttggaagaaccccgggctattgtgttagatcccatggttgggtacatg
tattggactgactggggagaaattccgaaaattgaacgagcagctctggatggttctgac
cgtgtagtattggttaacacttctcttggttggccaaatggtttagcattggattatgat
gaaggcaaaatatactggggagatgccaaaacagacaaaattgaggttataaatactgat
ggcaccgggagacgagtattagtggaagacaaaattcctcacatatttggatttactttg
ttgggtgactacgtttactggactgactggcagaggcgtagcattgaaagagtacataaa
cgaagtgcagagagggaagttatcatagatcagctgcctgacctcatgggcctaaaggcc
acaaatgttcatcgcgtgattggttccaacccctgcgcagaggaaaatgggggatgtagt
catctctgcctctatagacctcagggccttcgctgtgcttgccctattggttttgaactc
atcagtgacatgaagacctgcattgtcccagaggctttccttttgttttcacggagagca
gatatcagacgaatttctttggaaacaaacaataataatgtggctattccactcactggt
gtcaaggaagcttctgctttggattttgatgtgacagacaaccgaatttactggactgat
atatcactcaagaccatcagcagagcctttatgaatggcagtgctctggaacatgtggta
gaattcggcttggattatccagaaggcatggcagtagactggcttgggaagaacttgtac
tgggcagacacaggaacaaatcgaattgaggtgtcaaagttggatgggcagcaccgacaa
gttttggtgtggaaagacctagatagtcccagagctctagcattggaccctgctgaagga
tttatgtattggaccgaatggggtggaaaacctaagatagacagagctgcaatggatgga
agtgaacgtactaccttagttccaaatgtggggcgggcaaatggcctgactattgattat
gctaaaaggaggctttattggacagatctggacaccaacttaatagaatcttcaaatatg
cttggactcaaccgtgaagttatagcagatgacttgcctcatccttttggcttaactcag
taccaagattatatctactggacagactggagccgacgcagcattgagcgtgccaacaaa
accagtggccaaaaccgcaccgtcattcagggccatttggattatgtgatggacattctc
gtctttcactcctctcgacagtcagggtggaatgaatgtgcttccagcaatgggcactgc
tcccacctctgcttggctgtgccagttgggggttttgtttgtggatgccctgcccactac
tctcttaatgctgacaacaagacttgtagtgctcctaccactttcctgctcttcagtcaa
aagagtgctatcaaccgcatggtgattgatgaacaacagagccctgacatcatccttccc
atccacagccttcggaatgtccgggccattgactatgacccactggacaagcaactctat
tggattgactcacgacaaaacatgatccgaaaggcacaagaagatggcagccagggcttt
actgtggttgtgagctctgttccgagtcagaacctggaaatacaaccttatgacctcagc
attgatatttacagccgctatatctactggacttgtgaggctgccaatgtcattaatgtg
acaagattagatgggagatcaattggagtggtgctaaaaggcgagcaggacagacctcga
gccattgtggtaaacccagagaaagggtatatgtattttaccaatcttcaggaaaggtct
cctaaaattgaacgggctgctttggatgggacagaacgggaggtcctgtttttcagtggc
ttaagtaaaccaattgctttagcccttgatagcaggctgggcaagctcttttgggccgat
tcagatctccggcgaattgaaagcagtgatctctcaggtgctaaccggatagtactagaa
gactccaatatcttgcagcctgtgggacttactgtgtttgaaaactggctctattggatt
gataaacagcagcaaatgattgaaaaaattgacatgactggtcgagagggtagaaccaaa
gtccaggctcgaattgcccagcttagtgacattcatgcagtaaaggagctgaaccttcaa
gaatatagacagcacccttgtgctcaggataatggtggctgttcacatatttgtcttgta
aagggggatggtactacaaggtgttcttgccccgtgcacctggttctgcttcaagatgag
ctatcatgtggagaacccccaacatgttctcctcagcagtttacttgtttcacgggggaa
attgactgtatccccgtggcttggcgatgcgatgggtttactgaatgtgaagaccacagt
gacgaactcaattgtcccgtgtgctcagagtcccagttccagtgtgccagtgggcagtgt
attgatggtgccctccggtgcaacggagatgcaaactgccaggacaaatcagatgagaag
aactgtgaagtgctttgtttaattgatcagttccgctgtgccaatggtcagtgcattgga
aagcacaagaagtgtgatcataatgtggattgtagtgacaaatcagatgaactggattgt
tatccaactgaagaaccagcaccgcaggccaccaatacagtcggttctgttattggagta
attgtcaccatttttgtgtctggaaccatatactttatctgccagaggatgttgtgtcca
cgtatgaaaggagatggggaaaccatgactaatgactatgtagttcatggaccagcttct
gtgcctcttggttatgtgccacacccaagttctttgtcaggatctcttccaggaatgtct
cgaggtaaatcaatgataagctccctcagtatcatggggggtagcagtggacccccctat
gatagagctcatgttacaggagcatcatcaagcagttcttcaagcaccaaaggcacttac
ttccccgcaattttgaaccctccaccatccccagctacagaacgatcacattacactatg
gaatttggatattcttcaaacagtccttctactcataggtcatacagctacaggccatat
agttaccggcactttgcaccccctaccacaccctgcagcacagatgtttgtgacagtgac
tatggtcctagccggagaatgacctcagtggcaacagccaagggctataccagtgatttg
aactatgattcagaacctgtgcccccacctcccacacctcgaagccaatacttgtcggca
gaggagaactatgaaagctgcccgccttctccatatacagagaggagctattctcatcac
ctctacccaccgccaccctctccctgtacagactcctcctga

DBGET integrated database retrieval system