KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045138
Entry
101045138         CDS       T04350                                 

Gene name
VDAC3
Definition
(RefSeq) voltage-dependent anion-selective channel protein 3 isoform X2
  KO
K15041  voltage-dependent anion channel protein 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04020  Calcium signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04216  Ferroptosis
sbq04217  Necroptosis
sbq04218  Cellular senescence
sbq04613  Neutrophil extracellular trap formation
sbq04621  NOD-like receptor signaling pathway
sbq04979  Cholesterol metabolism
sbq05010  Alzheimer disease
sbq05012  Parkinson disease
sbq05016  Huntington disease
sbq05017  Spinocerebellar ataxia
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05161  Hepatitis B
sbq05166  Human T-cell leukemia virus 1 infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101045138 (VDAC3)
   04022 cGMP-PKG signaling pathway
    101045138 (VDAC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    101045138 (VDAC3)
   04217 Necroptosis
    101045138 (VDAC3)
   04218 Cellular senescence
    101045138 (VDAC3)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101045138 (VDAC3)
   04621 NOD-like receptor signaling pathway
    101045138 (VDAC3)
  09154 Digestive system
   04979 Cholesterol metabolism
    101045138 (VDAC3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101045138 (VDAC3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101045138 (VDAC3)
   05012 Parkinson disease
    101045138 (VDAC3)
   05016 Huntington disease
    101045138 (VDAC3)
   05017 Spinocerebellar ataxia
    101045138 (VDAC3)
   05020 Prion disease
    101045138 (VDAC3)
   05022 Pathways of neurodegeneration - multiple diseases
    101045138 (VDAC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101045138 (VDAC3)
   05161 Hepatitis B
    101045138 (VDAC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sbq03029]
    101045138 (VDAC3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sbq04040]
    101045138 (VDAC3)
Mitochondrial biogenesis [BR:sbq03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    101045138 (VDAC3)
Ion channels [BR:sbq04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   101045138 (VDAC3)
SSDB
Motif
Pfam: Porin_3
Other DBs
NCBI-GeneID: 101045138
NCBI-ProteinID: XP_003942433
LinkDB
Position
Unknown
AA seq 283 aa
MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLET
KYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTMFVPNTGKKSGKLKASYKR
DCFSIGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQL
HTHVNDGTEFGGSIYQKVNEKIETSINLAWTAGSNNTRFGIAAKYKLDCRTSLSAKVNNA
SLIGLGYTQTLRPGVKLTLSALIDGKNFSAGGHKVGLGFELEA
NT seq 852 nt   +upstreamnt  +downstreamnt
atgtgtaacacaccaacttactgtgacctaggaaaggctgctaaggatgtcttcaacaaa
ggatatggctttggcatggtcaagatagacctgaaaaccaagtcttgtagtggagtggaa
ttttctacttctggtcatgcttacactgatacagggaaagcatcaggcaacctagaaacc
aaatataaggtctgtaactatggacttaccttcacccaaaaatggaacacagacaatact
ctagggacagaaatctcttgggaaaataagttggctgaagggttgaaactgactcttgat
accatgtttgtaccgaacacaggaaagaagagtggaaaattgaaggcctcctataaacgg
gattgttttagtattggcagtaatgttgatatagatttttctggaccaaccatctatggc
tgggctgtgttggcctttgaagggtggcttgctggctatcagatgagttttgacacagcc
aaatccaaactgtcacagaataacttcgccctgggttacaaggctgcagacttccagctg
cacacacatgtgaatgatggcactgaatttggaggttctatctaccagaaggttaatgag
aagattgaaacgtcaataaaccttgcttggacggctgggagtaacaacactcgttttggc
attgctgctaaatacaagctggattgtagaacttctctctctgctaaagtaaataatgcc
agcctgattggactgggttatactcagactcttcgaccaggagtcaaattgaccttatca
gctttaattgatggaaagaacttcagtgcaggaggtcacaaggttggcttgggatttgaa
ctggaagcttaa

DBGET integrated database retrieval system