KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045311
Entry
101045311         CDS       T04350                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04915  Estrogen signaling pathway
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05223  Non-small cell lung cancer
sbq05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101045311 (TGFA)
   04012 ErbB signaling pathway
    101045311 (TGFA)
   04014 Ras signaling pathway
    101045311 (TGFA)
   04151 PI3K-Akt signaling pathway
    101045311 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101045311 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101045311 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101045311 (TGFA)
   05212 Pancreatic cancer
    101045311 (TGFA)
   05225 Hepatocellular carcinoma
    101045311 (TGFA)
   05214 Glioma
    101045311 (TGFA)
   05211 Renal cell carcinoma
    101045311 (TGFA)
   05215 Prostate cancer
    101045311 (TGFA)
   05223 Non-small cell lung cancer
    101045311 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101045311 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 101045311
NCBI-ProteinID: XP_003922696
UniProt: A0A2K6S3I1
LinkDB
Position
Unknown
AA seq 160 aa
MVPSAGQLALFALGMVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSMVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtcccctcggctggacagctcgccctgttcgcgctgggtatggtgttggccgcgtgc
caggctttggagaacagcacgtcccccctgagcgcagacccgcccgtggccgcagcagtg
gtgtcccattttaatgactgcccagattcccacactcagttctgcttccatggaacctgc
aggtttttggtgcaagaggacaagccagcatgtgtctgccattctgggtacgtcggtgca
cgctgtgagcatgcggacctcctggccgtggtggccgccagccagaagaagcaggccatc
actgccttggtggtggtctccatggtggcccttgctgtccttatcatcacatgtgtgctg
atacactgctgccaggtccgaaaacactgtgagtggtgccgggccctcatctgccggcac
gaaaagcccagcgccctcctgaagggaaggactgcttgctgccactcagaaacggtggtc
tga

DBGET integrated database retrieval system