KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045370
Entry
101045370         CDS       T04350                                 

Gene name
RALA
Definition
(RefSeq) ras-related protein Ral-A
  KO
K07834  Ras-related protein Ral-A
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq05132  Salmonella infection
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101045370 (RALA)
   04015 Rap1 signaling pathway
    101045370 (RALA)
   04072 Phospholipase D signaling pathway
    101045370 (RALA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101045370 (RALA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101045370 (RALA)
   05212 Pancreatic cancer
    101045370 (RALA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101045370 (RALA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101045370 (RALA)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:sbq04031]
    101045370 (RALA)
Membrane trafficking [BR:sbq04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    101045370 (RALA)
GTP-binding proteins [BR:sbq04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    101045370 (RALA)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 AAA_25 MMR_HSR1_Xtn ThiF ATP_bind_1
Other DBs
NCBI-GeneID: 101045370
NCBI-ProteinID: XP_003930806
UniProt: A0A2K6SLY3
LinkDB
Position
Unknown
AA seq 206 aa
MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
PFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRARKM
EDSKEKNGKKKRKSLAKRIRERCCIL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctgcaaataagcccaagggtcagaattctttggccttacacaaagtcatcatggtg
ggcagtggtggtgtgggcaagtcagctctgactctacagttcatgtacgatgagtttgtg
gaggactatgagcctaccaaagcagacagctatcggaagaaggtagtgctggatggggag
gaagtacagatcgatatcttagatacagctgggcaggaggactatgctgcaattagagac
aactacttccgaagcggggaagggttcctctgtgtcttctctattacagaaatggaatcc
tttgcagctacagctgacttcagggagcagattttaagagtaaaagaagatgagaatgtt
ccatttctactggttggtaacaaatcagatttagaagataaaaggcaggtttctgtggaa
gaggcaaaaaacagagctgaccagtggaatgttaactacgtggaaacatctgctaaaaca
cgagctaatgttgacaaggtattttttgatttaatgagagagattcgagcaagaaagatg
gaagacagcaaagaaaagaatggaaaaaagaagaggaaaagtttagccaagagaatcaga
gaaagatgctgcattttataa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052488
Entry
101052488         CDS       T04350                                 

Gene name
RALB
Definition
(RefSeq) ras-related protein Ral-B
  KO
K07835  Ras-related protein Ral-B
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101052488 (RALB)
   04015 Rap1 signaling pathway
    101052488 (RALB)
   04072 Phospholipase D signaling pathway
    101052488 (RALB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101052488 (RALB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101052488 (RALB)
   05212 Pancreatic cancer
    101052488 (RALB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101052488 (RALB)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:sbq04031]
    101052488 (RALB)
Membrane trafficking [BR:sbq04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    101052488 (RALB)
GTP-binding proteins [BR:sbq04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    101052488 (RALB)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase SRPRB GTP_EFTU MMR_HSR1 Gtr1_RagA AAA_25
Other DBs
NCBI-GeneID: 101052488
NCBI-ProteinID: XP_010340471
LinkDB
Position
Unknown
AA seq 206 aa
MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDK
IPLLVVGNKSDLEERRQVPVEEARSKAEEWSVQYVETSAKTRANVDKVFFDLMREIRAKK
MSENKDKNGKKSSKNKKSFKERCCLL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctgccaacaaaagtaagggccagagctccttggccctccacaaggtgatcatggtt
ggcagcggaggcgttggcaagtcggccctgacgcttcagttcatgtatgatgagtttgta
gaagactatgaacctaccaaagctgacagttatagaaagaaagtggttcttgatggggaa
gaagttcagatagacattctggacaccgctgggcaagaggactacgcagccattcgagat
aactactttcggagtggggaaggttttcttcttgtgttctcaatcacagaacatgaatcc
tttacagcaactgccgaattcagggaacagattctccgtgtgaaggctgaagaagataaa
attccattgctcgttgtgggaaacaagtctgacttagaggagcggaggcaggtgcctgtg
gaggaggccaggagtaaagccgaagagtggagcgtgcagtacgtggagacgtcggctaag
acgcgggccaacgtggacaaggtgttctttgacctaatgagagaaatcagagcaaagaag
atgtcagaaaacaaagacaagaatggcaagaaaagcagcaagaacaagaaaagttttaaa
gaaagatgttgcttactatga

DBGET integrated database retrieval system