KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045472
Entry
101045472         CDS       T04350                                 

Gene name
TLR2
Definition
(RefSeq) toll-like receptor 2
  KO
K10159  toll-like receptor 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04145  Phagosome
sbq04151  PI3K-Akt signaling pathway
sbq04613  Neutrophil extracellular trap formation
sbq04620  Toll-like receptor signaling pathway
sbq05132  Salmonella infection
sbq05134  Legionellosis
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05144  Malaria
sbq05145  Toxoplasmosis
sbq05146  Amoebiasis
sbq05152  Tuberculosis
sbq05161  Hepatitis B
sbq05162  Measles
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05205  Proteoglycans in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05321  Inflammatory bowel disease
sbq05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101045472 (TLR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101045472 (TLR2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101045472 (TLR2)
   04620 Toll-like receptor signaling pathway
    101045472 (TLR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101045472 (TLR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101045472 (TLR2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101045472 (TLR2)
   05321 Inflammatory bowel disease
    101045472 (TLR2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101045472 (TLR2)
   05134 Legionellosis
    101045472 (TLR2)
   05152 Tuberculosis
    101045472 (TLR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101045472 (TLR2)
   05161 Hepatitis B
    101045472 (TLR2)
   05171 Coronavirus disease - COVID-19
    101045472 (TLR2)
   05162 Measles
    101045472 (TLR2)
   05168 Herpes simplex virus 1 infection
    101045472 (TLR2)
   05169 Epstein-Barr virus infection
    101045472 (TLR2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101045472 (TLR2)
   05144 Malaria
    101045472 (TLR2)
   05145 Toxoplasmosis
    101045472 (TLR2)
   05140 Leishmaniasis
    101045472 (TLR2)
   05142 Chagas disease
    101045472 (TLR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101045472 (TLR2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101045472 (TLR2)
   04054 Pattern recognition receptors [BR:sbq04054]
    101045472 (TLR2)
   04090 CD molecules [BR:sbq04090]
    101045472 (TLR2)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101045472 (TLR2)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    101045472 (TLR2)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   101045472 (TLR2)
Pattern recognition receptors [BR:sbq04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   101045472 (TLR2)
CD molecules [BR:sbq04090]
 Proteins
  101045472 (TLR2)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Hyaluronan
  Cell surface receptors
   101045472 (TLR2)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_9 LRR_1 LRR_5 LRRCT TANGO2
Other DBs
NCBI-GeneID: 101045472
NCBI-ProteinID: XP_010336891
LinkDB
Position
Unknown
AA seq 784 aa
MPRTLWMVWALGAIISISKEESSDQASLSCDHNGICKGSPGSLNSIPSGLTAAVKSLDLS
NNRITYISNSDLQKCVNLQTLVLTSNGINRIEEDSFSSLGSLEHLDLSYNYLSNLSSSWF
KPLSSLTFLNLLENPYKILGETSLFSYLTKLRILRVGNMDTFTKLQRKDFAGLTFLEKLE
IDASNLQSYDPKSLKSIQNVSHLVLHMKQHILLSEIFVDITSSVEYLELQDTDLDTFHFS
ELSPGETNSLIKKFTFRNVKITDESLFQVLKLLNQISGLLELEFDDCTLNGVGDFRAPDD
DRAIDPGKVETFTIRRLHIPQFYLFYDLSTLYSLTERVKRITVENSKVFLVPCSLSQHLK
SLEYLDLSENLMVEEQLKNSACEDAWPSLQTLILRQNHLASLEETGKTLLTLKNLTNLDV
SKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLHLPQLK
ELYISRNKLATLPDASLLPVLLVLKISRNTINMFSKEQLDSFHTLKTLEAGGNNFICSCE
FLSFTQKQQALAKVLIDWPENYLCDSPSHVRGQRVQDVRLSVSECHRVALVSGMCCALFL
LILFIGCLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRDICYDAFVSYSERDAYWVENLMV
QELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFS
HFRLFDENNDAAILVLLEPIEKKAIPQRFCKLRKIMNTKTYLEWPTDEAQQEGFWVNLRA
AIKS
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgccacgtactttgtggatggtatgggccttaggggccatcatcagcatctccaaggaa
gaatcctccgatcaggcatctctgtcttgtgaccacaatggtatctgcaagggcagccca
ggatctttaaactccattccctcagggctcacagcagctgtaaaaagccttgacctgtct
aacaacaggatcacctacattagcaacagtgacctacagaagtgtgtgaacctccagact
ctggtgctaacatccaatggaattaacagaatagaggaagattctttttcttcccttggc
agtcttgaacatttagacttatcctataattacttatctaatttatcatcctcctggttc
aagcccctttcttctttgacattcttaaacttactggagaatccttacaaaatccttggg
gaaacatctcttttttcttatctcacaaaattgcgaatcctgagagtaggaaatatggac
accttcactaagcttcaaagaaaagattttgctggacttaccttccttgagaaacttgag
attgatgcttcaaatctacagagttatgacccaaaaagtttgaagtcaattcagaacgta
agtcatctggtccttcatatgaagcagcatattttactgtcggagattttcgtagatatt
acaagttctgtggaatatttggaactgcaagatactgatttggacacttttcacttttca
gagctatcccctggtgaaacaaattcattgattaaaaagtttacatttagaaatgtgaaa
atcaccgatgaaagtttgtttcaggtcctgaaacttttgaatcagatttctggactgtta
gaattagagtttgatgactgtacccttaatggagttggtgattttagagcacctgatgat
gacagagctatagatccaggtaaagtggagacgtttacaatccggaggctgcatattcca
cagttttacctattttatgatctgagtactttatattcactcacagaaagagttaaaaga
atcacagtagaaaacagtaaagtttttctggttccttgttcactttcacaacatttaaaa
tcattagaatacttggatctcagtgaaaatttgatggttgaagaacagttgaaaaattca
gcctgtgaggatgcctggccctctctacaaactttaattttaaggcaaaatcacttggca
tcattggaagagactggaaagactttgcttactctgaaaaacttgaccaaccttgatgtc
agtaagaatagttttcattctatgcctgaaacttgtcagtggccagaaaagatgaaatat
ttgaacttatccagcacacgaatacacagtgtaacaggctgcattcccaagacactggaa
attttagatgttagcaacaacaatctcaatttattttctttgcatttgccgcaactcaaa
gaactttatatttccagaaataagttggcgactctaccagatgcctccctcttacctgtg
ttactagtgttgaaaatcagtaggaatacaataaatatgttttctaaggagcaacttgac
tcttttcacacactgaagactttggaagctggtggcaataatttcatttgctcctgcgaa
ttcctctctttcactcagaagcagcaagcattggccaaagttctgatcgattggccagaa
aactacctgtgtgactctccatcccacgtgcgtggccaacgggttcaggatgtccgcctc
tcggtgtcagaatgccacagggtggcactagtgtctggcatgtgctgtgccctgttcctg
ctgatcctgttcatagggtgtctgtgccaccgtttccatggcctgtggtacatgaaaatg
atgtgggcctggctgcaggccaaaaggaagcccaggaaagctcccagcagggacatctgc
tatgatgcgtttgtttcttacagtgagcgggatgcctactgggtggagaaccttatggtc
caggagctggagaacttcaatccccccttcaagctgtgtctgcataagcgggacttcatt
cctggcaagtggatcattgacaatatcattgactccattgaaaagagccacaaaactgtc
tttgtactttctgaaaactttgtgaagagtgagtggtgcaagtatgaactggacttctcc
catttccgtctttttgatgagaacaatgatgctgccattctcgttcttctggagcccatt
gagaaaaaagccattccccagcgcttctgcaagctacggaagataatgaacaccaagacc
tacctcgagtggcccacagacgaggcccagcaggaagggttttgggtaaatctgagagct
gcgataaagtcctag

DBGET integrated database retrieval system