KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045517
Entry
101045517         CDS       T04350                                 

Gene name
HGF
Definition
(RefSeq) hepatocyte growth factor isoform X1
  KO
K05460  hepatocyte growth factor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04510  Focal adhesion
sbq05144  Malaria
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05211  Renal cell carcinoma
sbq05218  Melanoma
sbq05223  Non-small cell lung cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101045517 (HGF)
   04014 Ras signaling pathway
    101045517 (HGF)
   04015 Rap1 signaling pathway
    101045517 (HGF)
   04020 Calcium signaling pathway
    101045517 (HGF)
   04151 PI3K-Akt signaling pathway
    101045517 (HGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101045517 (HGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101045517 (HGF)
   05205 Proteoglycans in cancer
    101045517 (HGF)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101045517 (HGF)
   05226 Gastric cancer
    101045517 (HGF)
   05218 Melanoma
    101045517 (HGF)
   05211 Renal cell carcinoma
    101045517 (HGF)
   05223 Non-small cell lung cancer
    101045517 (HGF)
  09174 Infectious disease: parasitic
   05144 Malaria
    101045517 (HGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101045517 (HGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101045517 (HGF)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101045517 (HGF)
Cytokines and growth factors [BR:sbq04052]
 Growth factors
  Growth factors (RTK binding)
   101045517 (HGF)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101045517 (HGF)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986
Other DBs
NCBI-GeneID: 101045517
NCBI-ProteinID: XP_010343129
LinkDB
Position
Unknown
AA seq 729 aa
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGHKKRRNTIHEFKKSAKTTLIKIDPSLKIK
TKKVNTADECANRCTRNRGLPFTCKAFVFDKARKRCLWFPFNSMSNGVRKEFGHEFDLYE
NKDYIRNCIIGKGGSYKGTISITKSGIKCQPWSSMVPHEHSFLPSSYRGKDLQENYCRNP
QGEEGGPWCFTSNPEVRYEECDIPQCSEVECLICNGENYRGLMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPHTRWEYCAIKTCVADSTMNHTNVP
METTECVQGQGEGYRGTVNTIWNGIPCQRWDSQYPHKHDMTPENYKCKDLRENYCRNPDG
SESPWCFTTDPNIRIGYCSQIPNCDMSNGQDCYRGNGKNYMGNLSKTRSALTCSMWDKNM
EDLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVN
LDHPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPSR
DLKDYEAWLGIHDVHGRGDEKRKQVLNVSQLVYGPEGSDLVLLKLARPAVLDDFVSTIDL
PNYGCTIPEKTSCSVYGWGYTGLINYNGLLRVAHLYIVGNEKCNQYHQGKVILNESEICA
GVENIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAILNRPGVFVRVAYYAKWIHKI
ILTYKVPQS
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgtgggtgaccaaactcctgccagccctgctgctgcagcatgtcctcctgcatctcctc
ctgctccccatcgccatcccctatgcagagggacataagaaaagaagaaatacaattcat
gaatttaaaaagtcagcaaagactaccctaatcaaaatagacccatcactgaagataaaa
accaaaaaagtgaatactgcagacgaatgtgctaatagatgtactaggaatagaggactt
ccattcacttgcaaggcttttgtttttgacaaagcaagaaaacgatgcctctggtttccc
ttcaatagcatgtcaaatggagtgagaaaagaatttggccatgaatttgacctctatgaa
aacaaagactacattagaaactgcatcattggtaaaggaggcagctacaagggaacaata
tctatcactaaaagtggcatcaaatgtcagccctggagttccatggtaccacacgaacac
agctttttgccttcgagctatcggggtaaagacctacaggaaaactactgtcgaaatcct
caaggggaagaagggggaccctggtgtttcacaagcaatccagaggtacgctacgaagaa
tgtgacattcctcagtgttcagaagttgaatgcttgatctgcaatggggaaaattatcga
ggtctcatggatcatacagaatcaggcaagatttgccagcgctgggatcatcagacacca
caccggcataaattcttgcctgaaagatatcccgacaagggctttgatgataattattgc
cgcaatcccgatggcaagccgaggccatggtgctatactcttgaccctcacacccgctgg
gagtactgtgcaattaaaacatgtgtagccgacagtactatgaatcacactaatgttcct
atggaaacaactgaatgcgtacaaggtcaaggagaaggctacaggggcactgtcaatacc
atttggaatggaattccatgtcagcgttgggattctcagtatcctcacaaacatgacatg
actcctgaaaattataaatgcaaagacctacgagaaaattactgtcgaaatccagatggg
tctgaatcaccctggtgttttaccactgatccaaacatccgaattggctactgctcccaa
attccaaactgtgatatgtcaaatggacaagattgttatcgtgggaatggcaaaaattat
atgggcaatttatctaaaacaagatctgcactaacatgttcaatgtgggacaagaacatg
gaagacttacaccgtcatattttctgggaaccagatgcaagtaagctgaatgagaattac
tgccggaatccagatgatgatgctcatggaccctggtgctacacaggaaatccgctcatt
ccttgggattattgccccatttctcgttgtgaaggtgataccacacctacaatagtcaat
ttagaccatcctgtaatatcttgtgccaaaacgaaacaattgagagttgtaaatgggatt
ccaacacgaacaaatgtaggatggatggttagtttgaaatacagaaataaacatatctgc
ggaggatcactgataaaggaaagttgggttcttactgcacgacagtgtttcccttctcga
gacctgaaagattatgaagcttggcttggaattcatgatgtccatggaagaggagatgag
aaacgcaaacaggttctaaatgtttcccagctggtatatggccctgaaggatcagatctg
gttttactgaagcttgccaggcctgctgtcctggatgattttgtcagtacaattgattta
cctaattatggctgcacaattcctgaaaagacctcttgcagtgtttatggctggggctac
actggattgatcaactataacggtctattacgagtggcacatctctatatagtgggaaat
gagaaatgcaaccagtatcatcaagggaaggtgattctgaatgagtctgaaatatgtgca
ggggttgaaaacattggatcaggaccatgtgagggggattatggtggcccacttgtttgt
gaacaacataaaatgagaatggttcttggtgtcattgttcctggtcgtggatgtgccatt
ctaaatcgtcctggtgtttttgtccgagtagcatattatgcaaaatggatacacaaaatt
attttaacatataaggtaccacagtcatag

DBGET integrated database retrieval system