KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045636
Entry
101045636         CDS       T04350                                 

Gene name
MAP3K7
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 7 isoform X1
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04064  NF-kappa B signaling pathway
sbq04140  Autophagy - animal
sbq04152  AMPK signaling pathway
sbq04310  Wnt signaling pathway
sbq04380  Osteoclast differentiation
sbq04520  Adherens junction
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04660  T cell receptor signaling pathway
sbq04668  TNF signaling pathway
sbq05132  Salmonella infection
sbq05135  Yersinia infection
sbq05140  Leishmaniasis
sbq05145  Toxoplasmosis
sbq05161  Hepatitis B
sbq05162  Measles
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101045636 (MAP3K7)
   04310 Wnt signaling pathway
    101045636 (MAP3K7)
   04064 NF-kappa B signaling pathway
    101045636 (MAP3K7)
   04668 TNF signaling pathway
    101045636 (MAP3K7)
   04152 AMPK signaling pathway
    101045636 (MAP3K7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101045636 (MAP3K7)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101045636 (MAP3K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101045636 (MAP3K7)
   04621 NOD-like receptor signaling pathway
    101045636 (MAP3K7)
   04622 RIG-I-like receptor signaling pathway
    101045636 (MAP3K7)
   04660 T cell receptor signaling pathway
    101045636 (MAP3K7)
   04657 IL-17 signaling pathway
    101045636 (MAP3K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101045636 (MAP3K7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101045636 (MAP3K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101045636 (MAP3K7)
   05135 Yersinia infection
    101045636 (MAP3K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101045636 (MAP3K7)
   05161 Hepatitis B
    101045636 (MAP3K7)
   05171 Coronavirus disease - COVID-19
    101045636 (MAP3K7)
   05162 Measles
    101045636 (MAP3K7)
   05168 Herpes simplex virus 1 infection
    101045636 (MAP3K7)
   05169 Epstein-Barr virus infection
    101045636 (MAP3K7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101045636 (MAP3K7)
   05140 Leishmaniasis
    101045636 (MAP3K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101045636 (MAP3K7)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     101045636 (MAP3K7)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: TKL group
  MLK family
   101045636 (MAP3K7)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 101045636
NCBI-ProteinID: XP_010332083
UniProt: A0A2K6UPI5
LinkDB
Position
Unknown
AA seq 606 aa
MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSVQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRNHP
WTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI
ALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS
NT seq 1821 nt   +upstreamnt  +downstreamnt
atgtctacagcctcagccgcctcctcctcctcctcgtcttcggccggtgagatgatcgaa
gccccttctcaggtcctcaactttgaagagatagactacaaggagatcgaggtggaagag
gttgttggaagaggagcctttggagttgtttgcaaagcaaagtggagagcaaaagacgtt
gctattaaacaaatagaaagtgaatctgagaggaaagcttttattgtagagcttcggcag
ttatcccgtgtgaaccatcctaatattgtgaagctttatggagcctgcttgaatccagtg
tgtcttgtgatggagtatgctgaagggggctctttatataatgttctgcatggtgctgaa
ccattgccatattatactgcggcccacgctatgagttggtgtttacagtgttcccaagga
gtggcttatcttcacagtatgcaacccaaagcgctaattcacagggacctgaaaccacca
aacttactgctggttgcaggggggacagttctaaaaatttgtgactttggtacagcctgt
gacattcagacacacatgaccaataacaaggggagtgctgcttggatggcacctgaagtt
tttgaaggtagtaattacagtgaaaaatgtgacgtcttcagctggggtattattctttgg
gaagtgataacgcgtcggaaaccctttgatgagattggtggcccagctttccgaatcatg
tgggctgttcataacggtactcgaccaccactgatcaaaaatttacctaagcccattgag
agcctgatgactcgttgttggtctaaagatccttcccagcgcccttcaatggaagaaatt
gtgaaaataatgactcacttgatgcggtactttccaggagcagatgagccattacagtat
ccttgtcagtattcagatgaaggacagagcaactctgccaccagtacaggctcattcatg
gacattgcttctacaaatacaagtaataaaagtgacactaatatggagcaagttcctgcc
acaaatgatactatcaagcgcttagaatcaaaattgttgaaaaatcaggcaaaacaacag
agtgaatctggacgtttaagcttgggagcctcccgtgggagcagtgtggagagcttgcct
ccaacctcggagggcaagaggatgagtgctgacatgtctgaaatagaagctagaattgct
gcaaccacagcctattccaagcctaaacggggccaccgtaaaacagcttcatttggcaac
attctggatgtccctgagatcgtcatatcaggcaacggacagccaagacgtagatccgtc
caagacttgactgtaactggaacagaacctggtcaggtgagcagtaggtcatccagtccc
agtgtcagaatgatcactacctcaggaccaacctcagaaaagcctactagaaatcatcca
tggacccctgatgattccacagataccaatggatcagataactccatcccaatggcttac
cttacactggatcaccaactacagcctctagcaccgtgcccaaactccaaagaatctatg
gcagtgtttgaacagcattgtaaaatggcacaagaatatatgaaagttcaaacagaaatt
gcattgttattacagagaaagcaagaactagttgcagaactggaccaggatgaaaaggac
cagcaaaatacatctcgcctggtacaggaacataaaaagcttttagatgaaaacaaaagc
ctttctacttactaccagcaatgcaaaaaacaactagaggtcatcagaagtcagcagcag
aaacgacaaggcacttcatga

DBGET integrated database retrieval system