KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101046604
Entry
101046604         CDS       T04350                                 

Gene name
MCL1
Definition
(RefSeq) induced myeloid leukemia cell differentiation protein Mcl-1 isoform X1
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04630  JAK-STAT signaling pathway
sbq05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101046604 (MCL1)
   04151 PI3K-Akt signaling pathway
    101046604 (MCL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101046604 (MCL1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101046604 (MCL1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 101046604
NCBI-ProteinID: XP_003942012
UniProt: A0A2K6V5Y4
LinkDB
Position
Unknown
AA seq 350 aa
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLAAEKEASAQREVGGGEAGAVIGGS
AGASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPAADAIM
SPEDELDGYEPEPLGKRPAVLPLLELVGEPGHGSSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgttcggcctccaaagaaacgcggtaatcggactcaacctctactgtgggggggccggc
ttgggggccggcagcggcggcgccacccccccgggagggcggcttctggccgcggagaag
gaggcctcggcccagcgagaggtagggggaggggaggccggcgcggtgattggcggaagc
gccggcgctagccctccggccgccctgacgcctgacgcccggagggtcgtgcggccgccg
cccattggcgccgaggtccccgacgtcaccgcgaccccctcgaggctgctgttcttcgcg
cccacccgccgcgcggcgccgctggaggagatggaagccccggccgccgacgccatcatg
tcgcccgaagacgagctggacgggtacgagccggagcctctcgggaagcggccggctgtc
ctgcccctgctggagctggtcggggagcctggtcatggctccagtacggacgggtcactc
ccctcgacgccgccgcccgcagaggaggaggaggacgagttgtaccggcagtcgctggag
attatctctcggtacctccgggagcaggcgaccggcgccaaggacacaaagccaatgggc
aggtccggggccgccagcaggaaggcgctggagaccctgcggcgggtcggggacggcgtg
cagcgcaaccacgagacggccttccaaggcatgcttcggaaactggacatcaaaaacgaa
gacgatgtcaaatctttgtctcgagtgatggtccatgttttcagcgacggcgtaacaaac
tggggtaggattgtgactctcatttcttttggtgcctttgtggccaaacacttgaagacc
ataaaccaagaaagctgcattgaaccattagcagaaagtatcacagacgttctcgtaagg
acaaaacgggactggctagttaaacaaagaggctgggatgggtttgtggagttcttccat
gtagaggatctagaaggtggcatcagaaatgtgctgctggcttttgcaggtgttgctgga
gtaggagctggtttggcatatctaataagatag

DBGET integrated database retrieval system