KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101046701
Entry
101046701         CDS       T04350                                 

Gene name
FOS
Definition
(RefSeq) proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04024  cAMP signaling pathway
sbq04210  Apoptosis
sbq04380  Osteoclast differentiation
sbq04620  Toll-like receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04668  TNF signaling pathway
sbq04713  Circadian entrainment
sbq04725  Cholinergic synapse
sbq04728  Dopaminergic synapse
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04932  Non-alcoholic fatty liver disease
sbq04935  Growth hormone synthesis, secretion and action
sbq05031  Amphetamine addiction
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05135  Yersinia infection
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05161  Hepatitis B
sbq05162  Measles
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05224  Breast cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05323  Rheumatoid arthritis
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101046701 (FOS)
   04668 TNF signaling pathway
    101046701 (FOS)
   04024 cAMP signaling pathway
    101046701 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101046701 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101046701 (FOS)
   04660 T cell receptor signaling pathway
    101046701 (FOS)
   04658 Th1 and Th2 cell differentiation
    101046701 (FOS)
   04659 Th17 cell differentiation
    101046701 (FOS)
   04657 IL-17 signaling pathway
    101046701 (FOS)
   04662 B cell receptor signaling pathway
    101046701 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101046701 (FOS)
   04917 Prolactin signaling pathway
    101046701 (FOS)
   04921 Oxytocin signaling pathway
    101046701 (FOS)
   04926 Relaxin signaling pathway
    101046701 (FOS)
   04935 Growth hormone synthesis, secretion and action
    101046701 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    101046701 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    101046701 (FOS)
   04728 Dopaminergic synapse
    101046701 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101046701 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101046701 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101046701 (FOS)
   05231 Choline metabolism in cancer
    101046701 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101046701 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101046701 (FOS)
   05224 Breast cancer
    101046701 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101046701 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    101046701 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101046701 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101046701 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101046701 (FOS)
   05135 Yersinia infection
    101046701 (FOS)
   05133 Pertussis
    101046701 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101046701 (FOS)
   05170 Human immunodeficiency virus 1 infection
    101046701 (FOS)
   05161 Hepatitis B
    101046701 (FOS)
   05171 Coronavirus disease - COVID-19
    101046701 (FOS)
   05162 Measles
    101046701 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101046701 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101046701 (FOS)
   05142 Chagas disease
    101046701 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101046701 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101046701 (FOS)
   04131 Membrane trafficking [BR:sbq04131]
    101046701 (FOS)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    101046701 (FOS)
Membrane trafficking [BR:sbq04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    101046701 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Other DBs
NCBI-GeneID: 101046701
NCBI-ProteinID: XP_003924613
UniProt: A0A2K6SQC6
LinkDB
Position
Unknown
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNGQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPTASAGAYSRAGVVKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEDMSVASLDLTGGLPEATTPESEEAFS
LPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctcgggcttcaacgcagactacgaggcgtcctcctcccgctgcagcagcgcg
tccccggccggggacagtctctcctactaccactcacccgctgactccttctccagcatg
ggctcgcctgtcaacggccaggacttctgcacggacctggctgtctccagtgccaacttc
attcccacggtcactgccatctcgaccagtccggacctgcaatggctggtgcagcccgcc
ctcgtctcctccgtggccccatcgcagaccagagcccctcaccccttcggagtccccact
gcctccgctggggcttactccagggctggcgttgtgaagaccatgacaggcggccgagcg
cagagcattggcagaaggggcaaagtggaacagttatctccagaagaagaagagaaaagg
agaatccgaagggaaaggaataagatggctgcagccaaatgccgcaaccggaggagggag
ctgactgatacactccaagcggagacagaccaactagaagatgagaagtctgctttgcag
actgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggctgctcac
cgacctgcctgcaagatccctgatgacctgggcttcccagaagacatgtctgtggcttcc
cttgatctgactgggggcctgccagaggccaccaccccggagtctgaggaggccttcagc
ctgcctctcctcaatgaccctgagcccaagccctcagtggagcctgtcaagagcatcagc
agcatggagctgaaagctgagccctttgatgacttcctgttcccagcatcatccaggccc
agtggctctgagacagcccgctctgtgccagacatggacctgtctgggtccttctatgca
gcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagagctg
gagcccctgtgcactccggtggtcacctgcactcccagctgcactgcttacacgtcttcc
ttcgtcttcacctaccccgaggctgactccttccccagctgcgcagctgcccatcgcaag
ggcagcagcagcaatgagccctcctctgactcgctcagctcacccacgctgctggccctg
tga

DBGET integrated database retrieval system