KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101046845
Entry
101046845         CDS       T04350                                 

Gene name
DBI
Definition
(RefSeq) acyl-CoA-binding protein isoform X3
  KO
K08762  diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein)
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101046845 (DBI)
SSDB
Motif
Pfam: ACBP
Other DBs
NCBI-GeneID: 101046845
NCBI-ProteinID: XP_003931597
UniProt: A0A2K6UYW5
LinkDB
Position
Unknown
AA seq 87 aa
MSQAEFEKAAEEVKNLKTKPGDDEMLFIYGHYKQATVGDINTERPGMLDFKGKAKWDAWN
ELKGTTKEDAMKAYINKVEELKKKYGM
NT seq 264 nt   +upstreamnt  +downstreamnt
atgtctcaggctgagtttgagaaagctgcagaagaagttaagaaccttaagaccaagcca
ggagatgatgagatgcttttcatctatggccactacaaacaagcgactgtgggcgacata
aatacagaacggcctgggatgttggacttcaagggcaaggccaagtgggatgcctggaat
gagctgaaagggactaccaaggaagatgccatgaaagcttacatcaacaaagtggaagag
ctaaagaaaaaatacgggatgtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053856
Entry
101053856         CDS       T04350                                 

Definition
(RefSeq) diazepam-binding inhibitor-like 5
  KO
K08762  diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein)
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101053856
SSDB
Motif
Pfam: ACBP
Other DBs
NCBI-GeneID: 101053856
NCBI-ProteinID: XP_010338261
LinkDB
Position
Unknown
AA seq 87 aa
MFQVEFELARAALKQLKGPVSDQDKLLLYGWYKQATRGDCHLPAPPASDLKAKAKWEAWT
ANQGMSRMDAMRAYVAKVEELTRKEAG
NT seq 264 nt   +upstreamnt  +downstreamnt
atgttccaagtggagttcgagctggcgcgcgccgccctcaagcagctgaagggccccgtg
agcgatcaggacaagctgctgctctacggctggtacaagcaggccacccggggcgactgc
cacctccccgcccctcccgcgtccgacctgaaggccaaggccaagtgggaggcgtggacc
gcgaaccaagggatgtccaggatggacgccatgagggcctatgtggccaaagtggaggag
ctaaccaggaaggaggccggctga

DBGET integrated database retrieval system