KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101046847
Entry
101046847         CDS       T04350                                 

Gene name
BIRC5
Definition
(RefSeq) baculoviral IAP repeat-containing protein 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01524  Platinum drug resistance
sbq04210  Apoptosis
sbq04215  Apoptosis - multiple species
sbq04390  Hippo signaling pathway
sbq05161  Hepatitis B
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101046847 (BIRC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101046847 (BIRC5)
   04215 Apoptosis - multiple species
    101046847 (BIRC5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101046847 (BIRC5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101046847 (BIRC5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101046847 (BIRC5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101046847 (BIRC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sbq01002]
    101046847 (BIRC5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbq03036]
    101046847 (BIRC5)
Peptidases and inhibitors [BR:sbq01002]
 Peptidase inhibitors
  Family I32: IAP family
   101046847 (BIRC5)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     101046847 (BIRC5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    101046847 (BIRC5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 101046847
NCBI-ProteinID: XP_003931730
LinkDB
Position
Unknown
AA seq 105 aa
MAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELT
LGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRHAIEQLAAME
NT seq 318 nt   +upstreamnt  +downstreamnt
atggccgaggcgggcttcatccactgcccgactgagaacgagccggacttggcccagtgt
ttcttctgcttcaaggagctggaaggctgggagccagatgacgaccccatagaggaacat
aaaaagcattcatctggttgcgctttcctttctgtcaagaagcagtttgaagaattaacc
ctcggtgaatttctgaaactggacagagaaagagccaagaacaaaattgcaaaggaaacc
aacaataagaagaaagaatttgaagaaactgcgaagaaagtacgccatgccatcgagcag
ctggctgccatggagtga

DBGET integrated database retrieval system