KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101046861
Entry
101046861         CDS       T04350                                 

Gene name
STK4
Definition
(RefSeq) serine/threonine-protein kinase 4
  KO
K04411  serine/threonine kinase 4
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04068  FoxO signaling pathway
sbq05200  Pathways in cancer
sbq05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101046861 (STK4)
   04014 Ras signaling pathway
    101046861 (STK4)
   04068 FoxO signaling pathway
    101046861 (STK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101046861 (STK4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    101046861 (STK4)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: STE group
  STE20 family
   101046861 (STK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Mst1_SARAH Pkinase_fungal Abi_2 Haspin_kinase DUF4611
Other DBs
NCBI-GeneID: 101046861
NCBI-ProteinID: XP_003936462
UniProt: A0A2K6U1I2
LinkDB
Position
Unknown
AA seq 487 aa
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQ
VPVESDLQEIIKEISIMQQCDSHHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK
RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNP
PPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFVKSAKGVSILRDLINEAMDV
KLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDT
LPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLQ
NSSDWKVPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK
KRRQQNF
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggagacggtacagctgaggaacccgccgcgccggcagctgaaaaaattggatgaagat
agtttaaccaaacaaccagaagaagtgtttgatgttttagagaaacttggagaagggtct
tatggcagcgtttacaaagctattcataaagagactggtcagattgttgctattaagcaa
gttcctgtggaatcagacctgcaggagataatcaaagaaatctctataatgcagcaatgt
gacagccatcatgtagtcaaatattatggcagttattttaagaacacagacttatggatc
gttatggagtactgtggggctggttctgtatctgatatcattcgattacgaaataaaacg
ttaacagaagatgaaatagctacaatattacaatcaactcttaagggacttgagtacctt
cattttatgagaaaaatacaccgagatatcaaggcaggaaatattttgctaaatacagaa
ggacatgcaaaacttgcagattttggggtagcaggtcaacttacagatacgatggccaag
cggaatacagtgataggaacaccattttggatggctccagaagtgattcaggaaattgga
tacaactgtgtagcagacatctggtccctgggaataactgccatagaaatggctgaagga
aagcccccttatgccgatatccatccaatgagggcaatcttcatgattcctacaaatcct
cctcccacattccgaaaaccagagctgtggtcagataactttacagattttgtgaaacag
tgtcttgtaaagagccctgagcagagagccacagccactcagctcctgcagcacccattt
gtcaagagtgccaaaggagtgtcaatactgcgagacttaattaatgaagccatggatgtg
aaactgaaacgccaggaatcccagcagcgggaagtggaccaggacgatgaagaaaactca
gaagaagatgagatggattctggcacgatggttcgagcagtgggtgatgagatgggcact
gtccgagtagccagcaccatgactgatggagccaatactatgattgagcacgatgacaca
ttgccgtcacagctgggcaccatggtgatcaatgcagaggatgaggaagaggaagggact
atgaagagaagggatgagacaatgcagcctgccaaaccatcttttcttgaatattttgaa
caaaaagaaaaggaaaaccagatcaacagctttggcaagagtgtacctggtccactgcaa
aattcttcagattggaaagtaccacaggatggagactatgagtttcttaagagttggaca
gtggaggaccttcagaagaggctcttggccctggaccccatgatggagcaggagattgaa
gagatccggcagaagtaccagtccaagcggcagcccatcctggatgccattgaggctaag
aagaggcggcagcaaaacttctga

DBGET integrated database retrieval system