KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101046905
Entry
101046905         CDS       T04350                                 

Gene name
FADD
Definition
(RefSeq) FAS-associated death domain protein
  KO
K02373  FAS-associated death domain protein
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01524  Platinum drug resistance
sbq04210  Apoptosis
sbq04215  Apoptosis - multiple species
sbq04217  Necroptosis
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04668  TNF signaling pathway
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05142  Chagas disease
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101046905 (FADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101046905 (FADD)
   04215 Apoptosis - multiple species
    101046905 (FADD)
   04217 Necroptosis
    101046905 (FADD)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101046905 (FADD)
   04621 NOD-like receptor signaling pathway
    101046905 (FADD)
   04622 RIG-I-like receptor signaling pathway
    101046905 (FADD)
   04657 IL-17 signaling pathway
    101046905 (FADD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101046905 (FADD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101046905 (FADD)
   05022 Pathways of neurodegeneration - multiple diseases
    101046905 (FADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101046905 (FADD)
   05152 Tuberculosis
    101046905 (FADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101046905 (FADD)
   05161 Hepatitis B
    101046905 (FADD)
   05160 Hepatitis C
    101046905 (FADD)
   05164 Influenza A
    101046905 (FADD)
   05162 Measles
    101046905 (FADD)
   05168 Herpes simplex virus 1 infection
    101046905 (FADD)
   05163 Human cytomegalovirus infection
    101046905 (FADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101046905 (FADD)
   05169 Epstein-Barr virus infection
    101046905 (FADD)
   05165 Human papillomavirus infection
    101046905 (FADD)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101046905 (FADD)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101046905 (FADD)
SSDB
Motif
Pfam: Death DED
Other DBs
NCBI-GeneID: 101046905
NCBI-ProteinID: XP_003941212
LinkDB
Position
Unknown
AA seq 214 aa
MDPFLVLLHSVSSGLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSVLLEQNDLEPGRT
ELLRELLASLRRHDLLRRLDGEECGVACLQTSVNRSVPSLPDLGAAFDLICDHVGKDWKR
LARQLKVSDAKIDSIEDRHPRNLMERVRESLRIWRNTEKENATVAHLVGALRACQMNLVA
DLVEELQQARELQSRSGAVSPMSWNSDASTSEAS
NT seq 645 nt   +upstreamnt  +downstreamnt
atggacccgttcctggtgctgctgcactcggtgtcgtccggcctgtcgagcagcgagctg
accgagctcaagttcctgtgcctcgggcgcgtgggcaagcgcaagctggagcgcgtgcag
agcggcctggacctcttctccgtgctgctggagcagaacgacctggagcccgggcgcacg
gagctgctgcgcgagctgctcgcctccctgcggcgccacgacctgctgcggcgcctggat
ggggaggagtgtggggtcgcctgtctccaaacctctgtaaaccgttctgttccttccctc
ccagacctgggtgcagcatttgacctcatatgtgatcacgtggggaaagactggaaaaga
ctcgctcgtcagctcaaagtctcagacgccaagatcgacagcattgaggacagacacccc
cgcaacctgatggagcgcgtgagggagtcgctgagaatctggagaaacacagagaaggag
aacgcgactgtggcccacctggtgggggctctccgggcctgccagatgaacctggtggct
gaccttgtggaagagcttcagcaggcccgggagctccagagcaggagcggggccgtgtcc
ccgatgtcgtggaactcggacgcatccacctctgaagcgtcatga

DBGET integrated database retrieval system