KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047051Help
Entry
101047051         CDS       T04350                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00010  Glycolysis / Gluconeogenesis
sbq00051  Fructose and mannose metabolism
sbq00052  Galactose metabolism
sbq00500  Starch and sucrose metabolism
sbq00520  Amino sugar and nucleotide sugar metabolism
sbq00524  Neomycin, kanamycin and gentamicin biosynthesis
sbq01100  Metabolic pathways
sbq01200  Carbon metabolism
sbq04066  HIF-1 signaling pathway
sbq04910  Insulin signaling pathway
sbq04930  Type II diabetes mellitus
sbq04973  Carbohydrate digestion and absorption
sbq05230  Central carbon metabolism in cancer
Module
sbq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sbq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101047051 (HK1)
   00051 Fructose and mannose metabolism
    101047051 (HK1)
   00052 Galactose metabolism
    101047051 (HK1)
   00500 Starch and sucrose metabolism
    101047051 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    101047051 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101047051 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101047051 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101047051 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101047051 (HK1)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    101047051 (HK1)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101047051 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101047051 (HK1)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101047051 (HK1)
Membrane trafficking [BR:sbq04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101047051 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 101047051
NCBI-ProteinID: XP_003928700
UniProt: A0A2K6V4S7
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLVDIMTRFKKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDIPENIVH
GSGSQLFDHVAECLGDFMEKKKIKDKKLPVGFTFSFPCQQSKIDEAVLITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLG
VEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT
KDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRSTPDGTEHGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVTCISDFLDYMGIKGPRMPLGF
TFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVDGDQGQMCINMEWGAFGDNGCLDD
IRTNYDRLVDEYSLNAGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAA
VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLRTEASS
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcacagctcctggcctattacttcacggagctgaaggatgaccaagtcaaa
aagattgacaagtatctctatgccatgcggctctctgatgaaactctcgtagatatcatg
actcgcttcaagaaggagatgaagaatggcctctcccgggattttaatccaacagccaca
gtcaagatgttgccaacatttgtaaggtccattcctgatggttctgaaaagggagatttc
attgccctggatcttggtgggtcttcctttcgaattctgcgggtgcaagtgaatcatgag
aaaaaccagaatgttcacatggagtctgaggtttatgacatcccagagaacatcgtgcac
ggcagtggaagccagctttttgatcatgttgctgagtgcctgggagatttcatggagaaa
aagaagatcaaggacaagaagttacctgtgggattcacattttcttttccttgccaacaa
tccaaaatagatgaggccgtcctgatcacctggacaaagcgatttaaagcgagcggcgtg
gaaggagcagatgtggtcaagctgctcaacaaagccataaaaaagcgaggggactatgat
gccaacattgtagctgtggtgaacgacacggtgggtaccatgatgacctgtggctatgac
gaccagcagtgtgaagtcggcctgatcattggcactggcaccaatgcttgctacatggag
gaactgaggcacattgatctggtggaaggagacgaggggaggatgtgtatcaacacggaa
tggggagcctttggagatgatggatccttagaagacatccggacggagtttgacagggag
atagacagaggatccctcaaccctggaaaacagctgtttgagaagatggtcagtggcatg
tacttgggagagctggttcgactgatcctggtcaagatggccaaggagggcctcttattt
gaagggcggatcaccccggagctgctcaccagagggaagtttaacaccagtgatgtgtca
gccatcgaaaagaataaggaaggtctgcacaatgccaaagaaatcctgacccgcctggga
gtggagccgtctgatgatgactgtgtttcggtccaacacgtgtgcaccattgtctcgttt
cgctcggccaacctggtggctgccacgctgggcgccatcttaaaccgcctgcgtgataac
aagggcacacctaggcttcggaccacggttggtgtcgacggctctctttacaagacgcac
ccacagtattcccggcgtttccacaagactctgaggcgcttggtgccggactccgatgtg
cgcttcctcctctcggagagtggcagcggcaagggggccgccatggtgacggcggtggcc
taccgcttggctgagcagcaccggcagatagaggagaccctggctcatttccacctcacg
aaggacatgctgctggaggtgaagaagaggatgcgggccgagatggagctgggcctgcgg
aagcagacgcacaacaatgccgtggtcaagatgctgccctccttcgtccggagcaccccg
gatgggaccgagcatggcgacttcttggccttggatcttggaggaactaatttccgtgtg
ctgctggtgaaaatccgtagtgggaaaaagagaacagtggaaatgcacaacaagatctac
gccattcctattgaaatcatgcagggcactggggaagagctgtttgatcacattgtcacc
tgcatctctgacttcctggactacatggggatcaaaggccccaggatgcccctgggcttc
acgttctcatttccctgccagcagacgagtctggatgcgggaatcttgatcacgtggaca
aagggttttaaggcaacagactgtgtggggcacgatgtagtcaccttattaagggatgcg
ataaaaaggagagaggaatttgacctggatgtggtggctgtagtcaatgacacggtgggc
accatgatgacctgtgcttatgaggagcccacctgtgaggtcggactcattgttgggacc
ggcagcaatgcctgctacatggaggagatgaagaacgtggagatggtggacggggaccag
gggcagatgtgcatcaacatggagtggggggcctttggggacaacgggtgtctggatgat
atcaggacaaattatgacagactggtggacgaatattccctaaatgccgggaaacaaagg
ttcgagaagatgatcagtggcatgtacctgggtgaaatcgtccgcaacatcttgatcgac
ttcaccaagaagggattccttttccgagggcagatctctgagccgctgaagacccggggc
atctttgagaccaagttcctctctcagatcgagagtgaccgattagcgctgctccaggtc
cgggccatcctccagcagctgggtctgaatagcacctgcgatgacagtatcctcgtcaag
acggtgtgcggggtggtgtccaggagggccgcgcagctatgtggcgcgggcatggctgcg
gtggtggataagatccgcgagaacagaggactggaccgtctgaacgtgactgtgggagtg
gacgggacgctctacaagcttcatccgcacttctccagaatcatgcaccagacggtgaag
gaactgtcaccaaaatgtaacgtgtccttcctcctatctgaggatggcagcggcaagggt
gctgccctcatcacggccgtgggcgtgcggttgcgcacagaggcaagcagctaa

DBGET integrated database retrieval system