KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047066
Entry
101047066         CDS       T04350                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein isoform X2
  KO
K04377  Myc proto-oncogene protein
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04110  Cell cycle
sbq04151  PI3K-Akt signaling pathway
sbq04218  Cellular senescence
sbq04310  Wnt signaling pathway
sbq04350  TGF-beta signaling pathway
sbq04390  Hippo signaling pathway
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04630  JAK-STAT signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq05132  Salmonella infection
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05213  Endometrial cancer
sbq05216  Thyroid cancer
sbq05219  Bladder cancer
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05222  Small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101047066 (MYC)
   04012 ErbB signaling pathway
    101047066 (MYC)
   04310 Wnt signaling pathway
    101047066 (MYC)
   04350 TGF-beta signaling pathway
    101047066 (MYC)
   04390 Hippo signaling pathway
    101047066 (MYC)
   04630 JAK-STAT signaling pathway
    101047066 (MYC)
   04151 PI3K-Akt signaling pathway
    101047066 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101047066 (MYC)
   04218 Cellular senescence
    101047066 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101047066 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101047066 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101047066 (MYC)
   05202 Transcriptional misregulation in cancer
    101047066 (MYC)
   05206 MicroRNAs in cancer
    101047066 (MYC)
   05205 Proteoglycans in cancer
    101047066 (MYC)
   05230 Central carbon metabolism in cancer
    101047066 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101047066 (MYC)
   05225 Hepatocellular carcinoma
    101047066 (MYC)
   05226 Gastric cancer
    101047066 (MYC)
   05216 Thyroid cancer
    101047066 (MYC)
   05221 Acute myeloid leukemia
    101047066 (MYC)
   05220 Chronic myeloid leukemia
    101047066 (MYC)
   05219 Bladder cancer
    101047066 (MYC)
   05213 Endometrial cancer
    101047066 (MYC)
   05224 Breast cancer
    101047066 (MYC)
   05222 Small cell lung cancer
    101047066 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101047066 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101047066 (MYC)
   05161 Hepatitis B
    101047066 (MYC)
   05160 Hepatitis C
    101047066 (MYC)
   05163 Human cytomegalovirus infection
    101047066 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101047066 (MYC)
   05169 Epstein-Barr virus infection
    101047066 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101047066 (MYC)
   03019 Messenger RNA biogenesis [BR:sbq03019]
    101047066 (MYC)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    101047066 (MYC)
Messenger RNA biogenesis [BR:sbq03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     101047066 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH TRH
Other DBs
NCBI-GeneID: 101047066
NCBI-ProteinID: XP_003933757
LinkDB
Position
Unknown
AA seq 519 aa
MPAVRSPLRIHETLPLAAGGHFALELTTPEQGRDSPDEGRLFCPFGDTSSPLPGPAPRKG
LLAAVWTLDFFRAVENEALATMPLNVSFSNRNYDLDYDSVQPYFYCDEEENFYQQQQQSE
LQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSTSCVSVTPFSPRGDNDGGGGSFSTADQL
EMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDS
GSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKPCASPDTSAFSPS
SDSLLSSTESSPRASPEPLVLHEETPPTTSSDSEEEQEDEEIDVVSVEKRQPPGKRSESG
SPSSGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNR
KCTSPRSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKAT
AYILSIQAEEQKLISEKDLLRKRRDQLKHKLEQLRNSCA
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgccagcggtccgcagccctctccgcatccacgaaactttgcccttagcagcgggcggg
cactttgcactggaacttacaacacccgagcaaggacgcgactctcccgacgaggggagg
ctattctgcccattcggggacacctcctcgccgctgccgggacccgctcctcggaaaggt
ctccttgccgcagtttggacgctggatttttttcgggcagtggaaaacgaggctctcgcg
acgatgcccctcaacgtcagcttcagcaacaggaactatgacctcgactacgactcggtg
cagccgtatttctactgcgacgaagaagagaacttctaccagcagcagcagcagagcgag
ctgcagccgccagcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccg
ccactgtccccgagccgccgctccgggctctgctcgacctcctgcgtttcggtcacgccc
ttctctcctcggggagacaacgacggcggtggcgggagcttctccacagccgaccagctg
gagatggtgacggagctgctgggaggagacatggtgaaccagagcttcatctgcgacccg
gacgacgagaccttcatcaaaaacatcatcatccaggactgtatgtggagcggcttctcg
gccgccgccaagctcgtctcagagaagctggcctcctaccaggctgcgcgcaaagacagc
ggcagcccgaaccccgcccgcgggcacagcgtctgctccacctccagcttgtacctgcag
gatctgagcgccgccgcctcggagtgcatcgacccctcggtggtcttcccgtacccgctc
aatgacagcagctcgcccaagccctgcgcctcgccagacaccagcgccttctccccgtcc
tcagactctctgctctcctcgaccgagtcctccccgcgggccagccccgagcccctggtg
ctgcatgaggagacaccgcccaccaccagcagcgactctgaggaggaacaagaggatgaa
gaaatcgacgtcgtttctgtggaaaagaggcagccccctggcaaaaggtcagagtcagga
tcaccctcttctggaggccacagcaaacctcctcacagcccactggtcctcaagaggtgc
cacgtctccacacatcagcacaattacgcagcccctccctccacgcggaaggactaccca
gctgccaagagggtcaagttggacagtgtcagagtcctgaggcagatcagcaacaaccga
aaatgcaccagccccaggtcctcagacaccgaggaaaatgacaagaggcgaacgcacaac
gtcctggagcgccagagaaggaacgagctcaaacggagcttctttgccctccgtgaccag
atcccagagctggaaaacaatgaaaaggcccccaaggtagttattcttaagaaagccaca
gcatacatcctgtccatccaagccgaggagcaaaagctcatttctgaaaaggacttgttg
cggaagcgacgggatcagttgaaacacaaacttgaacagctgcggaactcttgtgcataa

DBGET integrated database retrieval system