KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047083
Entry
101047083         CDS       T04350                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04012  ErbB signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04136  Autophagy - other
sbq04140  Autophagy - animal
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04218  Cellular senescence
sbq04371  Apelin signaling pathway
sbq04613  Neutrophil extracellular trap formation
sbq04630  JAK-STAT signaling pathway
sbq04659  Th17 cell differentiation
sbq04714  Thermogenesis
sbq04910  Insulin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04930  Type II diabetes mellitus
sbq04931  Insulin resistance
sbq04935  Growth hormone synthesis, secretion and action
sbq05010  Alzheimer disease
sbq05014  Amyotrophic lateral sclerosis
sbq05016  Huntington disease
sbq05017  Spinocerebellar ataxia
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05221  Acute myeloid leukemia
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101047083 (MTOR)
   04371 Apelin signaling pathway
    101047083 (MTOR)
   04630 JAK-STAT signaling pathway
    101047083 (MTOR)
   04066 HIF-1 signaling pathway
    101047083 (MTOR)
   04072 Phospholipase D signaling pathway
    101047083 (MTOR)
   04151 PI3K-Akt signaling pathway
    101047083 (MTOR)
   04152 AMPK signaling pathway
    101047083 (MTOR)
   04150 mTOR signaling pathway
    101047083 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101047083 (MTOR)
   04136 Autophagy - other
    101047083 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    101047083 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101047083 (MTOR)
   04659 Th17 cell differentiation
    101047083 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101047083 (MTOR)
   04920 Adipocytokine signaling pathway
    101047083 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    101047083 (MTOR)
   04919 Thyroid hormone signaling pathway
    101047083 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    101047083 (MTOR)
   04213 Longevity regulating pathway - multiple species
    101047083 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    101047083 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101047083 (MTOR)
   05206 MicroRNAs in cancer
    101047083 (MTOR)
   05205 Proteoglycans in cancer
    101047083 (MTOR)
   05230 Central carbon metabolism in cancer
    101047083 (MTOR)
   05231 Choline metabolism in cancer
    101047083 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101047083 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101047083 (MTOR)
   05212 Pancreatic cancer
    101047083 (MTOR)
   05225 Hepatocellular carcinoma
    101047083 (MTOR)
   05226 Gastric cancer
    101047083 (MTOR)
   05214 Glioma
    101047083 (MTOR)
   05221 Acute myeloid leukemia
    101047083 (MTOR)
   05215 Prostate cancer
    101047083 (MTOR)
   05224 Breast cancer
    101047083 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101047083 (MTOR)
   05014 Amyotrophic lateral sclerosis
    101047083 (MTOR)
   05016 Huntington disease
    101047083 (MTOR)
   05017 Spinocerebellar ataxia
    101047083 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    101047083 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101047083 (MTOR)
   04931 Insulin resistance
    101047083 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101047083 (MTOR)
   05168 Herpes simplex virus 1 infection
    101047083 (MTOR)
   05163 Human cytomegalovirus infection
    101047083 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101047083 (MTOR)
   05165 Human papillomavirus infection
    101047083 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101047083 (MTOR)
   01522 Endocrine resistance
    101047083 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101047083 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101047083 (MTOR)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101047083 (MTOR)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   101047083 (MTOR)
Membrane trafficking [BR:sbq04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    101047083 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 UME V-ATPase_H_N Phage_tube_2 EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 101047083
NCBI-ProteinID: XP_010344833
UniProt: A0A2K6UYA5
LinkDB
Position
Unknown
AA seq 2549 aa
MLGTGPAAATTTATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTAATTAAPATTTASTEGSNSESEAESTENSP
TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7650 nt   +upstreamnt  +downstreamnt
atgcttgggactggacctgccgccgccaccaccactgccaccacatctagcaatgtgagc
gttctgcagcagtttgccagtggcctgaagagccggaatgaggagaccagggccaaagct
gccaaggagctccagcactatgtcaccatggagctccgagagatgagtcaagaggagtct
actcgcttctatgaccagctgaaccatcacatttttgaattggtttccagctcagatgcc
aatgagaggaaaggtggcatcttggccatagccagcctcataggagtggaaggtgggaat
gccacccgaattggcagatttgccaactatcttcggaacctcctcccctccaatgaccca
gttgtcatggaaatggcatccaaggccattggccgccttgccatggcaggggacactttc
actgcggagtatgtggaatttgaggtgaagcgagccctggaatggctgggtgctgaccgc
aatgagggccggagacacgcagctgtcctggttctccgtgagctggccatcagcgtccct
accttcttcttccagcaagtgcagcccttctttgacaacatttttgtggccgtgtgggac
cccaaacaggccatccgtgagggagctgtagctgcccttcgtgcctgtctgattctcacc
acccagcgtgagccgaaggagatgcagaagcctcagtggtaccggcacacatttgaagaa
gcagagaaggggtttgatgagaccttggctaaagagaagggcatgaatcgggatgatcgg
atccatggagccctgctgatccttaatgagctggtccgaatcagcagcatggagggagag
cgtctgagagaagaaatggaagaaatcacacagcagcagctggtacacgacaagtactgc
aaagatctcatgggctttggaaccaagcctcgtcacattacccccttcaccagtttccag
gctgtgcagccccagcagtcaaatgccttggtggggctgctggggtacagctctcaccaa
ggcctcatgggatttggggcctcccccagcccagctaagtccaccctggtggagagccgg
tgttgcagagacttgatggaggagaaatttgatcaggtgtgccagtgggtgctgaaatgc
aggaatagcaagaactcgctgatccaaatgacaatccttaatttgttgccccgcttggct
gcattccgaccttctgccttcacagatacccagtatctccaagataccatgaaccacgtc
ctaagctgtgtcaagaaggagaaggaacgtacagcagccttccaagccctggggctactt
tccgtggctgtgaggtccgagtttaaggtctatttgcctcgtgtgctggacatcatccga
gcagccctgccccctaaggactttgcccataagaggcagaaggcaatgcaggtggatgcc
acagtctttacttgcatcagcatgcttgctcgagcaatggggccaggcatccagcaggat
atcaaggagctgctggagcccatgctggcagtgggactaagccctgccctcactgcggta
ctctatgacctgagccgtcagattccacagctaaagaaagacattcaagacgggctactg
aaaatgctgtccctggtccttatgcacaaacccctccgccacccaggcatgcccaagggc
ctggcccatcagctggcctcccctgggctcacgactctccctgaggccagtgatgtgggc
agcatcactcttgccctccgaacacttggcagctttgaatttgaaggtcactctctgacc
caattcgttcgccactgtgcggatcatttcctgaacagtgagcacaaggagatccgcatg
gaggctgcccgtacctgctcccgcctgctcacaccctccatccacctcatcagtggccat
gctcatgtggttagccagactgcagtgcaagtggtggcagatgtgctcagcaaactgctc
gtggttgggataacagatcctgaccctgacattcgctattgtgtcttggcgtccctggat
gagcgctttgatgcacacctggcccaggcggagaacttgcaggccttgtttgtggctctg
aatgaccaggtgtttgagatccgggagctggccatctgcactgtgggccgactcagtagc
atgaaccccgcctttgtcatgcctttcctgcgcaagatgctcatccagattttgacagag
ctggagcacagtgggattggaagaatcaaagagcagagtgcccgcatgctggggcacctg
gtctccaatgcccctagactcatccgcccctatatggagcctattctgaaggcattaatt
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaacaatgtcctggcc
acaataggagaattggcacaggttagtggcctggaaatgagaaaatgggttgatgagctt
tttattatcatcatggacatgctccaggattcctctttgttggccaaaaggcaggtggct
ctgtggaccctgggacagttggtggccagcactggctatgtggtagagccctacaggaag
taccctactttgcttgaggtgctactgaattttctgaagactgagcagaaccagggtaca
cgcagagaggccatccgtgtgttagggcttttaggggctttggatccctataagcacaaa
gtgaacattggcatgatagaccagtcccgggatgcctctgctgtcagcctgtcagaatcc
aagtcaagtcaggattcctctgactatagcactagtgaaatgctggtcaacatgggaaac
ctgcctttggatgagttctacccagccgtgtccatggtggccctgatgcggatcttccga
gaccagtcactgtctcaccatcacaccatggttgtccaggctatcaccttcatcttcaag
tccctgggactcaaatgtgtgcagttcctgccccaggtcatgcccacgttccttaatgtc
attcgggtctgtgatggggccatccgggaatttttgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatcagaccttatatggatgaaatagtcaccctcatgagagaa
ttctgggtcatgaacacctcaattcagagcacgatcattcttctcattgagcaaattgtg
gtagctcttgggggtgaatttaagttgtacctgccccagctgatcccgcacatgctgcgt
gtcttcatgcatgacaacagcccaggacgcattgtctcgatcaagttattggctgcaatc
cagctgtttggtgccaacctggatgactacctgcatttgctgttgcctcctattgtgaag
ttgtttgatgcccctgaagctcccctgccatctcgaaaggcagcgctggagaccgtggac
cgtttgacggagtccctggatttcactgactatgcctcccggatcattcaccctattgtt
cgaacactggaccagagcccagaactgcgctccacagccatggacacactgtcttcactt
gtttttcaactggggaagaagtaccaaattttcattccaatggtgaataaagttttggtg
cgacaccgaatcaatcatcagcgctacgatgtgctcatttgcagaattgtcaagggatac
acacttgctgatgaagaggaggatcctttgatttaccagcatcgaatgcttaggagtggc
cagggggatgcattggctagtggaccagtggaaacaggacccatgaagaaactgcacgtc
agcaccatcaacctccaaaaggcgtggggcgctgccaggagggtctccaaagacgactgg
ctggaatggctgaggcggctgagcctggagctgctgaaggactcatcatcaccctccctg
cgatcctgctgggccctggcgcaggcctacaacccgatggccagggatctcttcaatgct
gcatttgtgtcctgctggtctgagctgaatgaagatcaacaggatgagctcatcagaagc
atcgagttggccctcacctcccaagacattgctgaagtcacacaaaccctcttaaacttg
gctgagttcatggaacacagtgacaagggccccctgccactgagagacgacaatggcatt
gttctgctgggtgagagagctgccaagtgccgagcatatgccaaagcactacactacaaa
gaactggagttccagaaaggccccacccctgccattctagaatctctcatcagcattaat
aataagctacagcagccggaggcagcagccggagtgttggaatatgccatgaaacacttt
ggagagctggagatccaggctacctggtatgagaaactgcacgagtgggaggatgctctt
gtggcctatgataagaaaatggacaccaacaaggatgacccagagctgatgctgggccgc
atgcgctgccttgaggccctgggggaatggggtcaactccaccagcagtgctgtgaaaag
tggaccctggttaatgatgagacccaagccaagatggcccggatggctgctgcagctgcg
tggggtttaggtcagtgggacagcatggaagaatacacctgtatgatccctcgtgacact
catgatggggcattctatagagctgtgctggcactgcatcaagacctcttctccttggca
caacagtgcattgacaaggccagggacctgctggatgctgaattaactgcgatggcagga
gagagttacagtcgggcatatggggccatggtttcttgccacatgctgtccgagctggag
gaggttatccagtacaaacttgtccccgagcgacgagagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtatcgtagaggactggcagaaaatccttatggtgcgg
tcccttgtggtcagccctcatgaggacatgagaacctggctcaagtatgcaagcctgtgc
ggcaagagtggcaggctggctcttgctcataaaaccttagtgttgctcctgggagttgat
ccgtctcggcaacttgaccatcctctgccgacagttcaccctcaggtgacctatgcctac
atgaaaaacatgtggaagagtgctcgcaagatcgatgccttccagcacatgcagcatttt
gtccagaccatgcagcaacaggcccagcatgccatcgctactgaggaccagcagcataag
caggaactgcacaagctcatggcccgatgcttcctgaaacttggagagtggcagctgaat
ctacagggcatcaacgagagcacaatccccaaagtgctgcagtactacagcgctgccaca
gaacacgaccgcagctggtacaaggcctggcatgcgtgggcagtgatgaacttcgaagcc
gtgctacactacaaacatcagaaccaagcccgcgacgagaagaagaaactgcgtcatgcc
agcggggccaacatcaccaatgccaccactgccgccaccacggctgcccctgccaccacc
actgccagcaccgagggcagcaacagtgagagtgaagccgagagcactgagaacagcccc
accccatcgccgctgcagaagaaggtcactgaggatctgtccaaaaccctcctgatgtac
acagtgcctgccgtccagggcttcttccgttccatctccttgtcacgaggcaacaacctc
caggatacactcagagttctcaccttatggtttgattatggtcactggccagatgtcaat
gaagccttagtggagggggtgaaagccatccagattgatacctggctacaggttatacct
cagctcattgcaagaattgatacgcccagacccttggtgggacgtctcattcaccagctt
ctcacagacattggtcgataccacccacaggccctcatctaccctctgacagtggcttct
aagtctaccacgacagcccggcacaacgcagccaacaagattctgaagaacatgtgtgag
cacagcaacactctggtccagcaggccatgatggtgagtgaggagctgatccgagtggcc
atcctctggcatgagatgtggcacgaaggcctggaagaggcttctcgtttgtactttgga
gagaggaatgtgaaaggcatgtttgaggtgctggagcccttgcatgctatgatggaacgg
ggcccccagactctgaaggaaacatcttttaatcaggcctatggtcgagatttaatggag
gcccaagaatggtgcaggaagtacatgaaatcagggaatgtcaaggacctcactcaagcc
tgggacctctattatcatgtgttccgacgaatctcaaagcagctgccccagctcacatcc
ttagagctgcagtatgtctccccaaaacttctgatgtgccgggacctcgaattggctgtg
ccaggaacatatgaccccaaccagccaatcattcgcattcagtccatagcaccgtctttg
caagtcatcacgtccaagcagaggccccggaaattgacgcttatgggcagcaacgggcat
gagtttgttttccttctaaaaggccatgaagatctgcggcaggatgagcgtgtgatgcaa
ctctttggcctggttaacacccttctggccaatgacccaacatctcttcggaaaaacctc
agcatccagagatatgccgtcattcctttatcaaccaactctggcctcattggctgggtc
ccccactgtgacacgctgcacgccctcatccgggactacagggagaagaagaagatcctt
ctcaacattgaacatcgcatcatgttgaggatggctccggactatgatcacttgactctg
atgcagaaggtggaggtgtttgagcatgccgtcaataatacagctggagacgacctggcc
aagctgctgtggctgaaaagccccagctccgaggtgtggtttgaccgaagaaccaattat
acccgttctttagcggtcatgtcaatggttgggtatattttaggcctgggagatagacac
ccatccaacctgatgctggaccgtctgagtgggaagatcctgcacattgactttggggac
tgctttgaggttgctatgacccgagagaagtttccagagaagattccatttagactaaca
agaatgttgaccaatgctatggaggttacaggcctggatggcaactacagaatcacatgc
cacacggtgatggaggtgctgcgagagcacaaggacagtgtcatggctgtgctggaagcc
tttgtctatgaccccttgctgaactggaggctgatggacacaaataccaaaggcaacaag
cgatcccgaacgaggacggactcctactctgctggccagtcagtagaaattttggatggt
gtggaacttggggaaccagcccataagaaaacggggaccacagtgccagaatctattcat
tctttcattggagacggtttggtgaaaccagaggccctaaataagaaagctattcagatt
attaacagggttcgagataagctcactggtcgggacttctctcatgatgacactttggat
gttccaacacaagttgagctgctcatcaaacaagcgacatcccatgaaaacctctgccag
tgctacattggctggtgccctttctggtaa

DBGET integrated database retrieval system