KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047113
Entry
101047113         CDS       T04350                                 

Gene name
PIM1
Definition
(RefSeq) serine/threonine-protein kinase pim-1
  KO
K04702  proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04630  JAK-STAT signaling pathway
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq05200  Pathways in cancer
sbq05206  MicroRNAs in cancer
sbq05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101047113 (PIM1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101047113 (PIM1)
   05206 MicroRNAs in cancer
    101047113 (PIM1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101047113 (PIM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101047113 (PIM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101047113 (PIM1)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101047113 (PIM1)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   101047113 (PIM1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal APH Choline_kinase Seadorna_VP7
Other DBs
NCBI-GeneID: 101047113
NCBI-ProteinID: XP_003923273
UniProt: A0A2K6SFP3
LinkDB
Position
Unknown
AA seq 313 aa
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGTRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
NT seq 942 nt   +upstreamnt  +downstreamnt
atgctcttgtccaaaatcaactcgcttgcccacctgcgcgccgcgccctgcaacgacctg
cacgccaccaagctggcgcccggcaaggaaaaggagcccctggagtcgcagtaccaggtg
ggcccgctactgggcagcggcggcttcggctcggtctactcgggcacccgcgtctccgac
aacttgccggtggccatcaaacacgtggagaaggaccggatctccgactggggagagctg
cccaatggcacccgagtgcccatggaagtcgtcctgctgaagaaggtgagctccggcttc
tccggcgtcattaggctcctggactggttcgagaggcccgacagtttcgtcctgatcctg
gagaggcccgagccggtgcaagacctcttcgactttatcacggaaaggggggccctgcag
gaggagctggcccgcagcttcttctggcaggtgctggaggccgtgcggcactgccacaac
tgcggggtgctccaccgcgacatcaaggacgaaaacatcctcatcgacctcaatcgcggc
gagctcaagctcatcgacttcgggtcgggggcgctgctcaaggacaccgtctacaccgac
ttcgacgggacccgagtgtatagccctccagagtggatccgctaccatcgctaccatggc
aggtcggcggcggtctggtccctggggatcctgctgtatgatatggtgtgtggagatatt
ccttttgagcatgacgaagagatcatcaggggccaagttttcttcaggcagagggtctct
tcagagtgtcagcatctcattagatggtgcttggccctgagaccatcagataggccaacc
ttcgaagaaatccagaaccatccatggatgcaagatgttcttctgccccaggaaactgct
gagatccacctccacagcctgtcaccggggcccagcaaatag

DBGET integrated database retrieval system