KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047163Help
Entry
101047163         CDS       T04350                                 

Gene name
TK1
Definition
(RefSeq) thymidine kinase, cytosolic
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00240  Pyrimidine metabolism
sbq00983  Drug metabolism - other enzymes
sbq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101047163 (TK1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101047163 (TK1)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     101047163 (TK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 ATPase_2
Motif
Other DBs
NCBI-GeneID: 101047163
NCBI-ProteinID: XP_003931731
UniProt: A0A2K6SED5
LinkDB All DBs
Position
Unknown
AA seq 234 aa AA seqDB search
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSSSFCTHDRNTMEALPACLLRDVTQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVI
VAALDGTFQRKAFGTILNLVPLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVIGGADK
YHSVCRLCYFKKASGQAAGLDNKENCPVPGKPGEATAARKLFTPQQILQCSFTN
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcattaacctgcccaccgtgctgcccggatcccccagcaagacccggggacag
atccaggtgattctcgggccgatgttctctggaaaaagtacggagctgatgaggcgtgtt
cgtcgcttccagatcgctcagtacaagtgcctggtgatcaagtatgccaaggacactcgc
tacagcagcagcttctgcacacatgaccggaacaccatggaggcgctgcctgcctgcctg
ctccgagatgtgacccaggaggccctgggagtggctgtcataggcattgacgaggggcag
tttttccctgacatcgtggagttctgtgaggccatggccaacgctgggaagacggtcatt
gtggctgcactggacgggaccttccagaggaaggcattcgggaccatcctgaacctggtg
ccactggctgagagcgtggtgaagctgaccgcagtatgcatggagtgcttccgggaagcc
gcctacaccaagaggcttggcacggagaaggaggttgaagtgattggaggagcagacaag
tatcactctgtgtgtcgcctctgctacttcaagaaggcctcaggccaggctgccgggctg
gacaacaaagagaactgccccgtgccaggaaagccaggagaggccacagctgccaggaag
ctctttaccccgcagcagattctgcaatgtagcttcaccaactga

DBGET integrated database retrieval system