KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047165Help
Entry
101047165         CDS       T04350                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00010  Glycolysis / Gluconeogenesis
sbq00053  Ascorbate and aldarate metabolism
sbq00071  Fatty acid degradation
sbq00280  Valine, leucine and isoleucine degradation
sbq00310  Lysine degradation
sbq00330  Arginine and proline metabolism
sbq00340  Histidine metabolism
sbq00380  Tryptophan metabolism
sbq00410  beta-Alanine metabolism
sbq00561  Glycerolipid metabolism
sbq00620  Pyruvate metabolism
sbq01100  Metabolic pathways
Module
sbq_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101047165 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    101047165 (ALDH2)
   00620 Pyruvate metabolism
    101047165 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101047165 (ALDH2)
   00561 Glycerolipid metabolism
    101047165 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101047165 (ALDH2)
   00310 Lysine degradation
    101047165 (ALDH2)
   00330 Arginine and proline metabolism
    101047165 (ALDH2)
   00340 Histidine metabolism
    101047165 (ALDH2)
   00380 Tryptophan metabolism
    101047165 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101047165 (ALDH2)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101047165 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1235
Motif
Other DBs
NCBI-GeneID: 101047165
NCBI-ProteinID: XP_003932291
UniProt: A0A2K6SK99
LinkDB All DBs
Position
Unknown
AA seq 517 aa AA seqDB search
MLRAAARLGPRLGHRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTETGRLIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSTTEQGP
QVDETQFKKILGYINSGKQEGAKLLCGGGVAADRGYFIQPTVFGDVQDGMTIAKEEIFGP
VMQILKFKTMEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGSGRELGEYSLQAYTEVKTVTVKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgccgccgcccgcctcgggcctcgcctgggccaccgcctcttgtccgccgct
gctacccaggccgtgcccgcgcccaaccagcagcccgaggtgttctgcaaccagatcttc
ataaacaatgaatggcatgatgccgtcagcaggaaaacattccccaccgtcaatccgtcc
actggagaggtcatctgtcaggtagctgaaggggacaaggaagatgtggacaaggcagtg
aaggctgcccgggccgccttccagctaggctcaccatggcgccgcatggatgcatcacac
aggggccgactactgaaccgcctggctgatctgatcgagcgggaccggacctacctggcg
gccttggagaccctggacaatggcaagccctatgtcatctcctacctggtggatttggac
atggtcctcaaatgtctcaggtattatgccggctgggctgataagtaccacgggaaaact
attcctattgacggagacttcttcagctacacccgccatgaacctgtgggggtgtgtggg
cagatcatcccgtggaattttccactcctgatgcaagcgtggaagctgggcccagccttg
gcgactggaaacgtggttgtgatgaaggtagctgagcagacaccccttactgccctctat
gtggccaacctgatcaaggaggccggctttccccctggtgtggttaacattgttcctgga
tttggccctaccgccggggctgctattgcctcccatgaggatgtggacaaagtggcattc
acaggctccaccgagactggccgcctaatccaggtagctgccgggagtagcaacctcaag
agagtgaccctggagctaggggggaagagccccaatatcatcatgtcagatgccgacatg
gactgggccgtggagcaggcccactttgccctgttcttcaaccagggccagtgctgctgt
gccggctcccggaccttcgtgcaagaggacatctatgatgagtttgtggagcggagcgtt
gcccgggccaagtctcgggtggtcgggaacccctttgacagtacgactgagcaggggccg
caggtggatgaaactcagtttaagaagatcctcggctacatcaactctgggaaacaagaa
ggggcaaagctgctgtgtggtgggggcgttgctgccgaccgtggctactttatccagccc
actgtgtttggagatgtgcaggatggcatgaccatcgccaaggaggagatcttcgggcca
gtgatgcagattctgaagttcaagaccatggaggaagttgtcgggagagccaacaattcc
acgtacgggctggccgcggctgtcttcacaaaggacttggacaaggccaattacctgtct
caggccctccaggcgggcaccgtgtgggtcaattgctatgatgtgtttggcgcccagtca
ccctttggaggctacaaaatgtcagggagtggccgggagctaggcgagtacagccttcag
gcatacaccgaagtgaaaaccgtcacagtcaaagtgcctcagaagaactcctaa

DBGET integrated database retrieval system