KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047355
Entry
101047355         CDS       T04350                                 

Gene name
ATF6B
Definition
(RefSeq) LOW QUALITY PROTEIN: cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04022  cGMP-PKG signaling pathway
sbq04141  Protein processing in endoplasmic reticulum
sbq04151  PI3K-Akt signaling pathway
sbq04211  Longevity regulating pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04668  TNF signaling pathway
sbq04728  Dopaminergic synapse
sbq04911  Insulin secretion
sbq04915  Estrogen signaling pathway
sbq04918  Thyroid hormone synthesis
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq05020  Prion disease
sbq05030  Cocaine addiction
sbq05031  Amphetamine addiction
sbq05034  Alcoholism
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101047355 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101047355 (ATF6B)
   04022 cGMP-PKG signaling pathway
    101047355 (ATF6B)
   04151 PI3K-Akt signaling pathway
    101047355 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101047355 (ATF6B)
   04915 Estrogen signaling pathway
    101047355 (ATF6B)
   04926 Relaxin signaling pathway
    101047355 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    101047355 (ATF6B)
   04918 Thyroid hormone synthesis
    101047355 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    101047355 (ATF6B)
   04925 Aldosterone synthesis and secretion
    101047355 (ATF6B)
   04927 Cortisol synthesis and secretion
    101047355 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101047355 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    101047355 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    101047355 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101047355 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    101047355 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    101047355 (ATF6B)
   05031 Amphetamine addiction
    101047355 (ATF6B)
   05034 Alcoholism
    101047355 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101047355 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101047355 (ATF6B)
   05161 Hepatitis B
    101047355 (ATF6B)
   05163 Human cytomegalovirus infection
    101047355 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101047355 (ATF6B)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101047355 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 101047355
NCBI-ProteinID: XP_010330544
LinkDB
Position
Unknown
AA seq 710 aa
MVGGWGGKMAELMLLSEIADPTRFFTDNLLSPEDWDSTLYSGLDEVAEEQTQLFRCPEQD
VPFDGSSLDVGMDVSPPEPPWELLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTESSSQA
LGVGEVLHVKTESLAPPLCLLGDDPASSFETVQINVGLISDDSSDVQTKIEPVSPCSSIN
SEASLLSADSSSQAFIGEEVLEVKTESPSPSGCLLWDVPAPSLGAVQISMGPSPDGSSGK
ALPTRKPPLQPKPVVLTTVPMPPRTVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQPEGP
APSLPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEA
RLQAVLADNQQLRRENAALRRRLEALLAENSELKLGTGNRKVVCIMVFLLFIAFNFGPVS
ISEPPSAPVSPRVNKGEPRPRRHLLEFSEPVHGVEPLQGSSHGPEEPQPSPADQPSFRXG
AREDPSSFKGXTKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQ
KAQERQKSQPRKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTFY
VVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTR
VIHIKTSTVPPSLRKQPSPAPGNATGGPLPASAASQAHQASHQPLYLNHP
NT seq 2133 nt   +upstreamnt  +downstreamnt
atggttggggggtgggggggaaagatggcggagctgatgctcctcagtgagattgcggac
ccgacgcgtttcttcaccgacaacctgctgagcccggaggactgggacagcaccttgtat
tctggcctagatgaagtggccgaggagcagacgcagctcttccgttgcccggagcaggat
gtcccgtttgacggcagttccctggacgtggggatggatgtcagcccccctgagccccca
tgggaactcctgcccatctttccagatcttcaggtgaagtctgagccatcttccccctgc
tcttcctcctccctcagctcggaatcatcacatctctccacagaatcctccagccaggct
cttggggtaggagaggtgctccacgtgaagacagagtccttggcacccccactctgtctc
ctgggagatgacccagcatcctcgtttgaaaccgtccagatcaatgtaggcctcatctct
gatgattcctcagatgtccagaccaagatagaacctgtctctccatgttcctccatcaac
tctgaggcctccctgctctcagccgactcctccagccaggcttttataggagaggaggtc
ctggaagtgaagacagagtccccatccccttcagggtgcctcctgtgggatgtcccagcc
ccctcacttggagctgtccagatcagcatgggcccatcccctgatggctcctcagggaaa
gccctgcccacccggaagccgccactgcagcccaaacctgtggtgctaaccaccgtcccg
atgccacccagaactgtgcctcccagcaccactgttcttctgcagcctctcgtccagcca
cccccagtgtccccagttgtccttatccagggtgctattcgagtccagcctgaagggccg
gctccctctcttccacggcccgagaggaagagcatcgttcctgctcctatgcctggcaac
tcctgccctcctgaagtggatgcaaagctgctgaagcggcagcagcgaatgatcaagaac
agggagtcagcctgccagtcccggagaaagaagaaagagtatctgcaggggctggaggct
cggctgcaggcagtactggctgacaaccagcagctccgccgggagaatgctgccctccgg
cggcggctggaggccctgctggctgaaaacagcgagctcaagttaggaactggaaacagg
aaggtggtctgcatcatggtcttccttctcttcatcgccttcaactttggacctgtcagc
atcagtgagcctccttcagctcccgtctctcctcgggtgaacaagggggagcctcgaccc
cggagacacttgctggagttctcagagccagttcacggagttgaacctctccaggggtcc
tcccatggccctgaagagccccagcccagccccgcagaccagcccagtttcaggtgagga
gcgagagaggacccctcctcctttaagggnnncaccaaggagttactactgagagaccta
gaccagctcttcctctcctctgattgccggcatttcaaccgaaccgagtccctgaggctt
gctgacgagctcagtggctgggtccagcgccaccagagaggccggcggaagatccctcag
aaggcccaggagagacagaagtctcagccacggaagtcacctccagttaaggcagtcccc
atccaaccccctggacccccagaaagggattctgtgggccaactgcagctatatcgccac
ccagaccgttcacagccagcgttcttggatgcaattgaccggcgggaagacacattttat
gttgtctctttccgaagggatcacctgctgctcccagccatcagccacaacaagacctcc
cggcccaagatgtctctggtgatgcctgccatggcccccaatgagaccttgtcaggccgt
ggggccccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacaccagg
gtgatccacatcaagacctccacggtgcccccctcgctccgaaaacagccgtcccccgcc
ccgggcaatgccacaggtggccccttgccagcctctgcagccagccaggcccaccaggcc
tctcaccagcccctctacctcaatcatccctga

DBGET integrated database retrieval system