KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047374
Entry
101047374         CDS       T04350                                 

Gene name
CCR8
Definition
(RefSeq) C-C chemokine receptor type 8 isoform X1
  KO
K04183  C-C chemokine receptor type 8
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04062  Chemokine signaling pathway
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101047374 (CCR8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101047374 (CCR8)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101047374 (CCR8)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101047374 (CCR8)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101047374 (CCR8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sbq04030]
    101047374 (CCR8)
   04050 Cytokine receptors [BR:sbq04050]
    101047374 (CCR8)
   04090 CD molecules [BR:sbq04090]
    101047374 (CCR8)
G protein-coupled receptors [BR:sbq04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    101047374 (CCR8)
Cytokine receptors [BR:sbq04050]
 Chemokine receptors
  CC Chemokine
   101047374 (CCR8)
CD molecules [BR:sbq04090]
 Proteins
  101047374 (CCR8)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 101047374
NCBI-ProteinID: XP_003930933
LinkDB
Position
Unknown
AA seq 351 aa
MDYTLEPSGTMTDYYYPDSFSSPCDGEPIQRNGKLLLAVFYCLLFIFSLLGNSLVILVLV
VCKKLRSITDVYLLNLALSDLLFVFSFPFQTFYQLGEWVFGTVMCKVVSGFYYIGFFSSM
FFITLMSVDRYLAIVHAVYAIKVRTIRMGTVLSLAVWLTSIMATIPLLVFYQVTSEDGVL
QCDSSYNQQTLKWKIFTNFEMNILGLLIPFTIFTFCYIKILHQLKRCQNHNKTKATRLVL
IVVIASLLFWVPFNMVLFLTSLHSMRLLGGCVMSQQLIYATHVTEVISFTHCCVNPVIYA
FIGQKFKKHLSEIFQKSCSHIFFCLGRQTPRESCERSSSCQQHSSSTDYIL
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggattatacactcgagcccagtgggacaatgaccgactactactaccctgatagcttc
tcaagcccctgtgatggggaacctatccagagaaatggcaagttgctccttgctgtcttt
tattgcctcctgtttatattcagtcttctgggaaacagcctggttatcctggtcctcgtg
gtgtgcaagaagctgaggagcatcacagatgtatacctcttaaacctggccctgtctgac
ctgctttttgtcttctccttcccctttcagaccttttatcagctgggtgagtgggtgttt
gggactgtaatgtgcaaggtggtgtctggcttttattacattggcttcttcagcagcatg
tttttcatcaccctcatgagtgtggacaggtacctggccattgtccacgccgtgtatgcc
ataaaagtgaggacgatcaggatgggcacagtcctgagcctggcagtatggctaacctcc
attatggctaccatcccactgctagtgttttaccaagtgacctctgaagatggtgttcta
cagtgcgattcatcttacaatcaacagactctgaagtggaagatcttcaccaactttgaa
atgaacatcttaggcttgttgatcccattcaccatctttacattctgctacattaaaatt
ctgcaccagctgaagaggtgtcaaaaccacaacaagaccaaggccaccaggctggtgctc
attgtggtcattgcatctttacttttctgggtcccattcaacatggttcttttcctcact
tccctgcacagcatgcgcctcttggggggatgtgtcatgagccagcaactgatttatgcc
acccatgtcacagaagtcatttcctttactcactgctgcgtgaaccctgttatctatgct
ttcataggacagaaattcaagaaacacctctcagaaatatttcagaaaagttgcagccat
atcttcttctgcctaggaagacagacacccagggagagctgtgaaaggtcatcatcctgc
cagcagcattcctccagcacagactacattttgtga

DBGET integrated database retrieval system