KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047461
Entry
101047461         CDS       T04350                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04144  Endocytosis
sbq04151  PI3K-Akt signaling pathway
sbq04510  Focal adhesion
sbq04520  Adherens junction
sbq04540  Gap junction
sbq04630  JAK-STAT signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq04912  GnRH signaling pathway
sbq04915  Estrogen signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04934  Cushing syndrome
sbq05160  Hepatitis C
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101047461 (EGFR)
   04012 ErbB signaling pathway
    101047461 (EGFR)
   04014 Ras signaling pathway
    101047461 (EGFR)
   04015 Rap1 signaling pathway
    101047461 (EGFR)
   04630 JAK-STAT signaling pathway
    101047461 (EGFR)
   04066 HIF-1 signaling pathway
    101047461 (EGFR)
   04068 FoxO signaling pathway
    101047461 (EGFR)
   04020 Calcium signaling pathway
    101047461 (EGFR)
   04072 Phospholipase D signaling pathway
    101047461 (EGFR)
   04151 PI3K-Akt signaling pathway
    101047461 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101047461 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101047461 (EGFR)
   04520 Adherens junction
    101047461 (EGFR)
   04540 Gap junction
    101047461 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101047461 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101047461 (EGFR)
   04915 Estrogen signaling pathway
    101047461 (EGFR)
   04921 Oxytocin signaling pathway
    101047461 (EGFR)
   04926 Relaxin signaling pathway
    101047461 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    101047461 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101047461 (EGFR)
   05206 MicroRNAs in cancer
    101047461 (EGFR)
   05205 Proteoglycans in cancer
    101047461 (EGFR)
   05230 Central carbon metabolism in cancer
    101047461 (EGFR)
   05231 Choline metabolism in cancer
    101047461 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101047461 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101047461 (EGFR)
   05212 Pancreatic cancer
    101047461 (EGFR)
   05225 Hepatocellular carcinoma
    101047461 (EGFR)
   05226 Gastric cancer
    101047461 (EGFR)
   05214 Glioma
    101047461 (EGFR)
   05218 Melanoma
    101047461 (EGFR)
   05219 Bladder cancer
    101047461 (EGFR)
   05215 Prostate cancer
    101047461 (EGFR)
   05213 Endometrial cancer
    101047461 (EGFR)
   05224 Breast cancer
    101047461 (EGFR)
   05223 Non-small cell lung cancer
    101047461 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101047461 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101047461 (EGFR)
   05171 Coronavirus disease - COVID-19
    101047461 (EGFR)
   05163 Human cytomegalovirus infection
    101047461 (EGFR)
   05165 Human papillomavirus infection
    101047461 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101047461 (EGFR)
   01522 Endocrine resistance
    101047461 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101047461 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101047461 (EGFR)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101047461 (EGFR)
Protein kinases [BR:sbq01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   101047461 (EGFR)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101047461 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   101047461 (EGFR)
  Exosomal proteins of bladder cancer cells
   101047461 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH GAPT Kdo
Other DBs
NCBI-GeneID: 101047461
NCBI-ProteinID: XP_010330053
UniProt: A0A2K6TTC6
LinkDB
Position
Unknown
AA seq 1157 aa
MFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMFY
ENSYALAVLSNYDANKMGLKELPMRNLQEILHGAVRFSNNPALCNVDSIQWRDIVSNDFL
SNMSMDFQNHVAGCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCH
NQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVK
KCPRNYVVTDHGSCVRACGADSYEVEEDGVRKCKKCEGPCRKVCNGIGIGKFKDTLSINA
TNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPKELDILKTVKEITGFLLIQAWPEN
RTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYAN
TINWKKLFGTSSQKTKIINNRGENSCKATGHVCHSLCSSEGCWGPDPRDCVSCRNVSRGR
ECVEKCNILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDSCIQCAHYIDGPHCVK
TCPAGVMGENNTLVWKYADAGHVCHLCHSNCTYGCGGPGLEGCAIPGPKIPSIATGIVAA
LLLVLVVALGIGLFMRRRRIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFK
KIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPH
VCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRL
VHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTH
QSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMI
DADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDA
DEYLIPQQGFFSSPSTSRTPLLSSLSANSNNSTVACIDRNGLQTCPIKEDSFLQRYSSDP
TGALTEDSIDDSFLPVPEYINQCVPKRPAGSVQNPVYHNQPLNLAPSRDPHYQDPHSTAV
GNPEYLNTVQPTWVSSAVDSPDRWIQKAIHQISLDNPDYQQDFLPKEAKPNGMFKGPTAE
NAEYLRVAPQSSEFIGA
NT seq 3474 nt   +upstreamnt  +downstreamnt
atgttcaataactgtgaggtggtccttgggaatttggaaattacctacgtgcagaggaat
tatgatctttccttcttaaagaccatccaggaggtggctggttatgtactcatcgccctc
aacacagtggagcggattcctttggaaaacctgcagatcatcagaggaaatatgttctac
gaaaattcctatgccttagcagtcttatccaactatgatgcaaataaaatgggactgaag
gagctgcccatgagaaacttacaagaaatcctgcatggcgctgtgcggttcagcaacaac
cctgccctgtgcaacgtggacagcatccagtggcgggacatcgtcagcaacgactttctc
agcaacatgtcgatggacttccagaaccacgtggctggctgccaaaagtgtgatccaagc
tgtcccaatgggagctgctggggtgcaggggaggagaactgccagaaactgaccaaaatc
atctgtgcccagcagtgctccgggcgttgccgcggcaagtcccccagcgactgctgccac
aaccagtgtgccgcaggctgcacgggcccccgagagagtgactgcctggtctgccgcaaa
ttccgagacgaagccacatgcaaggacacctgccccccactcatgctctacaaccccacc
acatatcagatggacgtgaaccctgagggcaaatacagctttggtgccacctgcgtgaag
aagtgtccccgtaactatgtggtgacagatcacggctcgtgcgtccgagcctgcggggcc
gacagctacgaggtggaggaagacggcgtgcgcaagtgtaagaagtgtgaagggccttgc
cgcaaagtgtgtaacggaataggtattggtaaatttaaagacacgctctccataaatgct
acaaatattaaacacttcaaaaactgcacctccatcagcggtgatctccacatcctgccg
gtggcatttaggggtgactccttcacacacactccacctctggatccaaaggaactggat
attctgaaaaccgttaaggaaatcacagggtttttgctgattcaggcttggcctgaaaac
aggacggacctccatgcttttgagaacctggaaatcatacgcggcaggaccaagcaacat
ggtcagttttctcttgctgttgtcagcctgaacataacatccttgggattacgctccctc
aaggagataagcgatggagatgtgatcatttcaggaaacaaaaatttgtgctatgcaaat
acaataaactggaaaaaactgtttgggacctccagccagaaaaccaaaattataaacaac
agaggtgaaaacagctgcaaggccacaggccatgtctgccattctttgtgctcctccgag
ggctgctggggcccggaccccagggactgcgtctcctgtcggaacgtcagccggggcaga
gagtgcgtggagaagtgcaacattctggagggcgagccaagagagtttgtggagaactct
gagtgcatccagtgccacccggaatgcctgccccaggccatgaacatcacctgcacggga
cgggggccggacagctgcatccagtgtgcccactacatcgacggcccccactgcgtcaag
acctgcccggcaggggtcatgggagaaaacaacaccctggtctggaagtacgcggacgcc
ggccacgtgtgccacctgtgccattcaaactgcacctacggatgcggtgggccaggtctt
gaaggctgtgcaatacctgggcccaagatcccgtccatcgccactgggattgtggctgcc
ctcctgttggtgctggtggtggccctggggatcggcctcttcatgcggaggcgccgcatt
gtccgaaagcgcacgctgcggaggctgctgcaggagcgggagctcgtggagcctcttacg
cccagcggagaagctcctaaccaagccctcctgaggatcttgaaggaaactgaattcaaa
aagatcaaagtgctgggctctggcgcattcggcacggtgtataagggactctggatccca
gaaggtgagaaagttaaaattcccgtagctatcaaggagttaagagaagcaacgtctcca
aaagccaacaaggaaatcctggatgaggcctacgtgatggccagcgtggacaacccccat
gtgtgccgcctgctgggcatctgcctcacctccactgtgcaactcatcacgcagctcatg
cccttcggctgcctcttggactatgtccgggagcacaaggacaacatcggctcccagtac
ctgctcaactggtgtgtgcagatcgcaaagggcatgaactacctggaggaccgtcgcttg
gtgcaccgcgacctggcagccaggaacgtgctggtgaagacgccgcagcatgtcaagatc
acagattttgggctggccaaactgctgggggcagaagagaaggagtatcatgcggaagga
ggcaaagtgcctatcaagtggatggcgttggaatcaattttacaccgaatttatacccac
cagagtgatgtctggagttacggggtgactgtttgggagttgatgacctttggatccaag
ccatatgatggaatccctgccagcgagatctcctccatcctggagaaaggagagcgcctc
ccccagccacccatatgcaccattgatgtgtacatgatcatggtcaaatgctggatgata
gacgcagatagtcgcccaaagttccgtgagttgatcattgaattctccaaaatggcccga
gacccccagcgctacctggtcattcagggggatgaacgaatgcatttgccaagccctaca
gactccaacttctaccgcgccctgatggatgaagaagacatggacgacgtggtggatgcg
gacgagtacctcatcccacagcagggtttcttcagcagcccctccacgtcgcggactccc
ctcctcagctctctgagcgcaaacagcaacaattccactgtggcttgcattgatagaaac
gggctgcagacctgtcccatcaaggaagacagcttcttacagcgatacagctcagacccc
accggagccttgactgaggacagcatagacgactccttcctcccagtgcctgaatacata
aaccagtgtgttcccaaaaggcctgctggctctgtgcagaatcctgtctatcacaatcag
cccctgaacctcgcgcccagcagggacccacactaccaggacccccacagcaccgcagtg
ggcaaccccgagtatctcaacactgtgcagcccacctgggtcagcagcgcagtggacagc
cctgaccgctggatccagaaagccatccaccaaatcagcctggacaaccctgactaccag
caggacttccttcccaaggaagccaaacccaacggcatgtttaagggccccacagctgaa
aatgcagaatacctaagggtcgcgccacaaagcagtgaatttattggagcgtga

DBGET integrated database retrieval system