KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047749
Entry
101047749         CDS       T04350                                 

Gene name
CCND3
Definition
(RefSeq) G1/S-specific cyclin-D3 isoform X1
  KO
K10152  G1/S-specific cyclin-D3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04110  Cell cycle
sbq04115  p53 signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04218  Cellular senescence
sbq04310  Wnt signaling pathway
sbq04390  Hippo signaling pathway
sbq04510  Focal adhesion
sbq04630  JAK-STAT signaling pathway
sbq05162  Measles
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101047749 (CCND3)
   04390 Hippo signaling pathway
    101047749 (CCND3)
   04630 JAK-STAT signaling pathway
    101047749 (CCND3)
   04151 PI3K-Akt signaling pathway
    101047749 (CCND3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101047749 (CCND3)
   04115 p53 signaling pathway
    101047749 (CCND3)
   04218 Cellular senescence
    101047749 (CCND3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101047749 (CCND3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101047749 (CCND3)
   05203 Viral carcinogenesis
    101047749 (CCND3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101047749 (CCND3)
   05164 Influenza A
    101047749 (CCND3)
   05162 Measles
    101047749 (CCND3)
   05169 Epstein-Barr virus infection
    101047749 (CCND3)
   05165 Human papillomavirus infection
    101047749 (CCND3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 101047749
NCBI-ProteinID: XP_003923045
UniProt: A0A2K6SMV2
LinkDB
Position
Unknown
AA seq 292 aa
MELLCCEGTRQAPRAGPDPQLLGDQRVLQSLLRLEERYVPRTSYFQCVQREIKPHMRKML
AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLT
IEKLCIYSDHALSPRQMRDWEVLVLGKLKWDLAAVIAHDFLALILHRLPVPRERQALVKK
HAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDQLTEVLAGITGTEVDCL
RACQEQIETALRESLREAAQTSPSPAPKTPRGSSSQGSSQTSTPTDVTAIHL
NT seq 879 nt   +upstreamnt  +downstreamnt
atggagctgctgtgttgcgaaggcaccaggcaggcgccccgggccgggccggacccgcag
ctgctgggggaccagcgtgtcctgcaaagcctgctccgcctggaggagcgctacgtgccc
cgcacctcctacttccagtgcgtgcagcgggagatcaagccgcatatgcggaagatgctg
gcttactggatgctggaggtgtgtgaggagcagcgctgtgaggaggaagtcttccccctg
gccatgaactacctggatcgctacctgtcctgcgtccccacccgaaaggcgcagttgcag
ctcctgggtgcggtctgcatgctgctggcctccaagctgcgcgagaccacgcccctgacc
atcgaaaaactgtgcatctacagcgaccacgctctctctccccgccagatgcgggactgg
gaggtgctggtcctagggaagctcaagtgggacctggctgccgtgattgcacatgatttc
ctggccctcattctgcaccggctccctgtgccccgtgagcgacaggccttggtcaaaaag
catgcccagacctttttggccctctgtgctacagattatacctttgccatgtacccgcca
tccatgattgccacgggcagcattggggctgcagtgcaaggcctgggtgcctgctccatg
tccggggatcagctcacagaggtgctggcagggatcactggcactgaagtggactgcctg
cgggcctgtcaggagcagatcgaaactgcactcagggagagcctcagggaagccgctcag
accagccccagcccagcgcccaaaaccccccggggctccagcagccaagggtccagccag
accagcactcctacagatgtcacagccatccacctgtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047858
Entry
101047858         CDS       T04350                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1 isoform X1
  KO
K04503  G1/S-specific cyclin-D1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04068  FoxO signaling pathway
sbq04110  Cell cycle
sbq04115  p53 signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04218  Cellular senescence
sbq04310  Wnt signaling pathway
sbq04340  Hedgehog signaling pathway
sbq04371  Apelin signaling pathway
sbq04390  Hippo signaling pathway
sbq04510  Focal adhesion
sbq04530  Tight junction
sbq04630  JAK-STAT signaling pathway
sbq04917  Prolactin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04934  Cushing syndrome
sbq05160  Hepatitis C
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05216  Thyroid cancer
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101047858 (CCND1)
   04340 Hedgehog signaling pathway
    101047858 (CCND1)
   04390 Hippo signaling pathway
    101047858 (CCND1)
   04371 Apelin signaling pathway
    101047858 (CCND1)
   04630 JAK-STAT signaling pathway
    101047858 (CCND1)
   04068 FoxO signaling pathway
    101047858 (CCND1)
   04151 PI3K-Akt signaling pathway
    101047858 (CCND1)
   04152 AMPK signaling pathway
    101047858 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101047858 (CCND1)
   04115 p53 signaling pathway
    101047858 (CCND1)
   04218 Cellular senescence
    101047858 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101047858 (CCND1)
   04530 Tight junction
    101047858 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101047858 (CCND1)
   04921 Oxytocin signaling pathway
    101047858 (CCND1)
   04919 Thyroid hormone signaling pathway
    101047858 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101047858 (CCND1)
   05206 MicroRNAs in cancer
    101047858 (CCND1)
   05205 Proteoglycans in cancer
    101047858 (CCND1)
   05203 Viral carcinogenesis
    101047858 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101047858 (CCND1)
   05212 Pancreatic cancer
    101047858 (CCND1)
   05225 Hepatocellular carcinoma
    101047858 (CCND1)
   05226 Gastric cancer
    101047858 (CCND1)
   05214 Glioma
    101047858 (CCND1)
   05216 Thyroid cancer
    101047858 (CCND1)
   05221 Acute myeloid leukemia
    101047858 (CCND1)
   05220 Chronic myeloid leukemia
    101047858 (CCND1)
   05218 Melanoma
    101047858 (CCND1)
   05219 Bladder cancer
    101047858 (CCND1)
   05215 Prostate cancer
    101047858 (CCND1)
   05213 Endometrial cancer
    101047858 (CCND1)
   05224 Breast cancer
    101047858 (CCND1)
   05222 Small cell lung cancer
    101047858 (CCND1)
   05223 Non-small cell lung cancer
    101047858 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101047858 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101047858 (CCND1)
   04934 Cushing syndrome
    101047858 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101047858 (CCND1)
   05160 Hepatitis C
    101047858 (CCND1)
   05162 Measles
    101047858 (CCND1)
   05163 Human cytomegalovirus infection
    101047858 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101047858 (CCND1)
   05169 Epstein-Barr virus infection
    101047858 (CCND1)
   05165 Human papillomavirus infection
    101047858 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101047858 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101047858
NCBI-ProteinID: XP_010350208
LinkDB
Position
Unknown
AA seq 345 aa
MEHQLLCCEVEAIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIQPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLGSPNHFLSYYRLTCFLSRVIKCD
PVSGGDGRVGWRAADIQCHRNAEAGAKAPKGEKVGAGSFGRQATGSEHHQLLPLLLELTD
RLGVLTGLSHPLGLPGAGASSWAKRPGQRPQAAPASDPCGDGVWG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggaggccatccgccgcgcctaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctgaaggcggaggagacctgcgccccc
tccgtgtcctacttcaaatgtgtgcagaaggaggtcctgccgtccatgcggaagatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagccagtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctctaagatgaaagagaccatccccctgacg
gccgagaagctgtgcatctacaccgacaactccatccagcccgaggagctgctgcaaatg
gagctgctcctggtgaacaagctcaagtggaacctggccgccatgaccccgcacgatttc
atcgaacacttcctctccaaaatgccagaggcggaggagaacaaacagatcatacgcaaa
cacgcgcagaccttcgttgccctctgcgccacagatgtgaagttcatttccaatccgccc
tccatggtggcggcggggagcgtggtggccgcagtgcaaggcctgaacttggggagcccc
aaccacttcctgtcctactaccgcctcacctgcttcctctccagagtgatcaagtgtgac
ccggtgagtgggggcgatggccgagtgggctggcgggcagcagacatccagtgccacaga
aatgctgaggctggtgccaaggcccccaagggtgaaaaggttggggctgggtcctttgga
cgccaggccacgggctcggagcaccaccagcttcttcccctgctcctagaactcaccgac
cggctgggagtcctcacaggtctgtcacatcccctggggcttccaggagctggagcgtct
tcctgggcgaagcgtccaggacagaggccccaggcggccccagccagtgatccgtgtggt
gatggtgtgtggggatag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101049141
Entry
101049141         CDS       T04350                                 

Gene name
CCND2
Definition
(RefSeq) G1/S-specific cyclin-D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04068  FoxO signaling pathway
sbq04110  Cell cycle
sbq04115  p53 signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04218  Cellular senescence
sbq04310  Wnt signaling pathway
sbq04340  Hedgehog signaling pathway
sbq04390  Hippo signaling pathway
sbq04510  Focal adhesion
sbq04630  JAK-STAT signaling pathway
sbq04917  Prolactin signaling pathway
sbq05162  Measles
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05203  Viral carcinogenesis
sbq05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101049141 (CCND2)
   04340 Hedgehog signaling pathway
    101049141 (CCND2)
   04390 Hippo signaling pathway
    101049141 (CCND2)
   04630 JAK-STAT signaling pathway
    101049141 (CCND2)
   04068 FoxO signaling pathway
    101049141 (CCND2)
   04151 PI3K-Akt signaling pathway
    101049141 (CCND2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101049141 (CCND2)
   04115 p53 signaling pathway
    101049141 (CCND2)
   04218 Cellular senescence
    101049141 (CCND2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101049141 (CCND2)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101049141 (CCND2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101049141 (CCND2)
   05202 Transcriptional misregulation in cancer
    101049141 (CCND2)
   05206 MicroRNAs in cancer
    101049141 (CCND2)
   05203 Viral carcinogenesis
    101049141 (CCND2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101049141 (CCND2)
   05162 Measles
    101049141 (CCND2)
   05169 Epstein-Barr virus infection
    101049141 (CCND2)
   05165 Human papillomavirus infection
    101049141 (CCND2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 101049141
NCBI-ProteinID: XP_003942237
UniProt: A0A2K6STD2
LinkDB
Position
Unknown
AA seq 289 aa
MELLCCEVDPIRRAVRDRNLLQDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTA
EKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKH
AQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDV
DCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
NT seq 870 nt   +upstreamnt  +downstreamnt
atggagctgctgtgctgcgaggtggacccgatccgcagggccgtgcgggaccgcaacctg
ctccaggacgaccgcgtcctgcagaacctgctcaccatcgaggagcgctaccttccgcag
tgctcctacttcaagtgcgtgcagaaggacatccagccctacatgcgcaggatggtggcc
acctggatgctggaggtctgtgaggaacagaagtgcgaagaagaggtcttccctctggcc
atgaattacctggaccgtttcttggctggggtcccgactccaaagtcccatctgcaactc
ctgggtgctgtctgcatgttcctggcctccaagctcaaagaaaccagcccgctgactgcg
gagaagctgtgcatttacactgacaactccatcaagcctcaggagctgctggagtgggag
ctggtggtgctggggaagttgaagtggaacctggcagctgtcactcctcatgacttcatt
gagcacatcttgcgcaagctgcctcagcagcgggagaagctgtctctgatccgaaagcat
gcccagaccttcatcgctctgtgtgccaccgactttaagttcgccatgtacccaccatcg
atgatcgcaactggaagtgtgggagcagccatctgtggcctccagcaggatgaggaagtg
agttcgctcacttgcgatgccctgactgagctgctggctaagatcaccaacacagacgtg
gattgtctcaaagcctgccaggagcagattgaggccgtgctcctcaacagcctgcagcag
taccgtcaggaccagcgcgacggatccaagtcggaggatgaactggaccaagccagcacc
cctacagacgtgcgggatattgacctgtga

DBGET integrated database retrieval system