KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047975Help
Entry
101047975         CDS       T04350                                 

Gene name
MBD4
Definition
(RefSeq) methyl-CpG-binding domain protein 4 isoform X2
  KO
K10801  methyl-CpG-binding domain protein 4 [EC:3.2.2.-]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    101047975 (MBD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbq03036]
    101047975 (MBD4)
   03400 DNA repair and recombination proteins [BR:sbq03400]
    101047975 (MBD4)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     101047975 (MBD4)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    101047975 (MBD4)
DNA repair and recombination proteins [BR:sbq03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     101047975 (MBD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MBD HhH-GPD
Motif
Other DBs
NCBI-GeneID: 101047975
NCBI-ProteinID: XP_003926209
LinkDB All DBs
Position
Unknown
AA seq 564 aa AA seqDB search
MESLNLGDRGAAPAVSSSEHLVADPPSDLRKEDGAMELERVGEDEEQMMMKRSSECNPLL
QEPIASAQFGGTAGMVCHKSAPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRSKSSLA
NYLHKNGETSLKPEDFDFTVLSKRGIKSRYKECSMAALTSNPQNQSSNWNLRTRSKCKED
VFMPPTSSSELQDSRRLSKFTSTHLLLKEDEDVDDVHFRKVRKPKGKVTILKGTPMKKTR
KGCRKNHSGVAQSDSKRESVCNKTDAESEPVAQASQLDRTFCISDAGACGETLSVTSEEK
SLVKERSLSSRSNFCFEQKTSGIVNKLHSAKHAEHNKKYEDTFLESEEIGTKVEVGARKE
HLHIDLLKHGSEIDNCPPTKKDFTEDAIPRTQIERRKTSLYFSSKYNKEALSPPRRKVFK
KWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPSAEVARNADW
RDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKQV
HPEDHKLNKYHDWLWENHEKLSLS
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggagagcctgaatctgggggaccgcggagctgcccccgcagtctcctccagtgagcac
ctagtcgcagacccgccgagtgacctccgcaaggaagatggtgctatggaattggaaaga
gtgggagaagatgaggaacaaatgatgatgaaaagaagcagtgaatgtaatcccctgcta
caagaacccatcgcttctgctcagtttggtggtactgcagggatggtatgccataagtct
gccccgtgtggatgggaaagagttgtgaagcaaaggttatttggtaaaacagcaggaaga
tttgatgtatactttatcagcccacaaggactgaagttcagatccaaaagttcacttgct
aattatcttcacaaaaatggagagacttctcttaagccagaagattttgattttactgta
ctttctaaaaggggcatcaagtcaagatataaagaatgcagcatggcagccctgacatct
aatcctcaaaaccaaagttcaaactggaacctcaggacgcgaagcaagtgcaaagaggat
gtgtttatgccgccaacaagtagttcagagttgcaggatagcagaagactctctaagttt
acttccactcatttgctcttgaaagaagatgaggatgttgatgatgtgcacttcagaaag
gttagaaagcccaaaggaaaggtgacaattttgaaaggaaccccaatgaagaaaactaga
aaaggatgcaggaagaaccattcaggtgttgctcaaagtgatagcaaaagagaatctgtg
tgtaataaaacagatgctgaaagtgagcctgttgcacaagcaagtcagcttgatagaact
ttctgcatttctgatgctggagcatgtggtgagaccctcagtgtgaccagcgaagaaaag
agccttgtaaaagaaagatcattgagttcaagatcaaatttttgttttgaacaaaaaact
tctggcattgtaaacaaactacattcagccaaacacgcagaacacaacaagaagtatgag
gatacctttttagaatctgaagaaatcggaacaaaagtagaagttggggcgaggaaggaa
catttgcatattgaccttttaaaacatggctctgaaatagacaactgcccaccaaccaag
aaagactttactgaagatgccatcccacgaacacagatagaaagaaggaaaacaagcctg
tatttttccagcaaatataacaaagaagctcttagccccccaagacgtaaagtctttaag
aaatggacacctcctcggtcaccttttaatcttgttcaagaaacactttttcacgatcca
tggaagcttctcatcgctactatattcctcaatcggacctcaggcaaaatggcaatacct
gtgctttggaagtttctggagaagtacccttcagcagaggtagcaagaaacgcagactgg
agagatgtgtcagaacttcttaaacctcttggtctctacgatcttcgggcaaaaaccatt
gtcaagttctcagatgaatatctgacaaagcagtggaagtatccgattgaactccatggg
attggtaaatacggcaacgactcttaccgaattttttgtgtcaatgagtggaagcaggtg
caccctgaagaccacaaattaaataaatatcatgactggctttgggaaaatcatgaaaaa
ttaagtctgtcttaa

DBGET integrated database retrieval system