KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047980
Entry
101047980         CDS       T04350                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1 isoform X2
  KO
K13375  transforming growth factor beta-1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04068  FoxO signaling pathway
sbq04110  Cell cycle
sbq04218  Cellular senescence
sbq04350  TGF-beta signaling pathway
sbq04380  Osteoclast differentiation
sbq04390  Hippo signaling pathway
sbq04659  Th17 cell differentiation
sbq04672  Intestinal immune network for IgA production
sbq04926  Relaxin signaling pathway
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05144  Malaria
sbq05145  Toxoplasmosis
sbq05146  Amoebiasis
sbq05152  Tuberculosis
sbq05161  Hepatitis B
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05220  Chronic myeloid leukemia
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05321  Inflammatory bowel disease
sbq05323  Rheumatoid arthritis
sbq05410  Hypertrophic cardiomyopathy
sbq05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101047980 (TGFB1)
   04350 TGF-beta signaling pathway
    101047980 (TGFB1)
   04390 Hippo signaling pathway
    101047980 (TGFB1)
   04068 FoxO signaling pathway
    101047980 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101047980 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101047980 (TGFB1)
   04218 Cellular senescence
    101047980 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101047980 (TGFB1)
   04672 Intestinal immune network for IgA production
    101047980 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101047980 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101047980 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101047980 (TGFB1)
   05205 Proteoglycans in cancer
    101047980 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101047980 (TGFB1)
   05212 Pancreatic cancer
    101047980 (TGFB1)
   05225 Hepatocellular carcinoma
    101047980 (TGFB1)
   05226 Gastric cancer
    101047980 (TGFB1)
   05220 Chronic myeloid leukemia
    101047980 (TGFB1)
   05211 Renal cell carcinoma
    101047980 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101047980 (TGFB1)
   05321 Inflammatory bowel disease
    101047980 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101047980 (TGFB1)
   05414 Dilated cardiomyopathy
    101047980 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101047980 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101047980 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101047980 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101047980 (TGFB1)
   05161 Hepatitis B
    101047980 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101047980 (TGFB1)
   05144 Malaria
    101047980 (TGFB1)
   05145 Toxoplasmosis
    101047980 (TGFB1)
   05140 Leishmaniasis
    101047980 (TGFB1)
   05142 Chagas disease
    101047980 (TGFB1)
Chaperones and folding catalysts [BR:sbq03110]
 Intramolecular chaperones
  Others
   101047980 (TGFB1)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   101047980 (TGFB1)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101047980 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 101047980
NCBI-ProteinID: XP_003943233
UniProt: A0A2K6SA43
LinkDB
Position
Unknown
AA seq 391 aa
MPPSGLRLLPLLLPPILWLLVLTLGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRL
ASPPNQAEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHHE
IYDKFKHSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKAEQHVELYQKYSNNSW
RYLSNRLLAPSDSTEWLSFDVTGVVRQWLTHGGEMEGFRLSAHCSCDSQDNTLQVDINGF
STGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLY
IDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQ
ALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgctgccgctgctgctgccgccgattctgtggctactg
gtgctgacgctcggccggccggccgcgggactatccacctgcaagaccatcgacatggag
ctggtgaagcggaagcgcatcgaggccatccgtggccagatcctgtccaagctgcggctc
gccagccccccgaaccaggcggaggtgccgccgggcccgctgcccgaggccgtgctcgcc
ctgtacaacagcacccgcgaccgggtggccggggagagcgccgagccggagcccgagccg
gaggccgactactacgccaaggaggtcacccgcgtgctcatggtggaaacccaccacgaa
atctatgacaagttcaagcacagcacacacagcatatatatgttcttcaacacatcagag
ctccgagaagcagtacctgaacccgtgttgctctcccgggcagagctgcgtctgctgagg
ctcaagttaaaagcggagcagcacgtggagctgtaccagaaatacagcaacaattcctgg
cgatacctcagcaaccggctactggctcccagcgactcgacggagtggttgtcttttgat
gtcactggagttgtgcgacagtggctgacccatggaggggaaatggaaggctttcgtctt
agcgcccactgctcctgtgacagccaagataacacactgcaagtggacatcaacgggttc
tctactggccgccgaggtgatctggccaccattcatggcatgaaccggcctttcctgctt
ctcatggccaccccgctggagagagcccagcatctgcaaagctcccggcaccgcagagcc
ctggacaccaactactgcttcagctccacggagaagaactgctgcgtgcggcagctgtac
attgacttccgcaaggacctcggctggaagtggatccatgagcccaagggctaccatgcc
aacttctgcctggggccctgcccctacatttggagcctggacacacagtacagcaaggtc
ctggccctgtacaaccagcataacccgggcgcctcggcggcgccgtgctgtgtgccgcag
gcgctggagccgctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctg
tccaacatgatcgtgcgctcctgcaagtgcagctga

DBGET integrated database retrieval system