KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101048222
Entry
101048222         CDS       T04350                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic protease-activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01524  Platinum drug resistance
sbq04115  p53 signaling pathway
sbq04210  Apoptosis
sbq04215  Apoptosis - multiple species
sbq05010  Alzheimer disease
sbq05012  Parkinson disease
sbq05014  Amyotrophic lateral sclerosis
sbq05016  Huntington disease
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05134  Legionellosis
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05164  Influenza A
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101048222 (APAF1)
   04215 Apoptosis - multiple species
    101048222 (APAF1)
   04115 p53 signaling pathway
    101048222 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101048222 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101048222 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101048222 (APAF1)
   05012 Parkinson disease
    101048222 (APAF1)
   05014 Amyotrophic lateral sclerosis
    101048222 (APAF1)
   05016 Huntington disease
    101048222 (APAF1)
   05020 Prion disease
    101048222 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    101048222 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    101048222 (APAF1)
   05152 Tuberculosis
    101048222 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101048222 (APAF1)
   05160 Hepatitis C
    101048222 (APAF1)
   05164 Influenza A
    101048222 (APAF1)
   05162 Measles
    101048222 (APAF1)
   05168 Herpes simplex virus 1 infection
    101048222 (APAF1)
   05169 Epstein-Barr virus infection
    101048222 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101048222 (APAF1)
SSDB
Motif
Pfam: NB-ARC WD40 APAF1_C ANAPC4_WD40 CARD eIF2A CARD_2 Ge1_WD40 WD40_like AAA_16 Utp8 AAA_18 ATPase_2 AAA_22
Other DBs
NCBI-GeneID: 101048222
NCBI-ProteinID: XP_010338630
LinkDB
Position
Unknown
AA seq 1173 aa
MDAKARNCLLQHREVLEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMI
LKKDNGSYISFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVP
QRPVVFVARKKLVNAIQQKLSKLNGEPGWVTIYGMAGCGKSVLAAEAVRDHSLLKRCFPG
GVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLHKHPSSLL
ILDDIWDPWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVN
MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLRQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKNYYTDLSILPKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYYQLPSLLPDQEDC
MYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAV
SENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGTLYLEWINK
KTIMNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
LCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHNYDEHSEQVNCCHFTNSSHHFLLATGS
SDCVLKLWDLNQKQCRNTLFGHINSVNHCRFSPDDKLLASCSADGTLKLWDTTSANERKS
INVKQFFLNSEDPQEDMDVIVKCCSWSADGARIMVAAKNKIFLFDIHTSDLLGEIHMGHH
STIQYCDFFPQNHLAVVALSQYCVELWNIDSRSKVADCRGHLSWVHGVMFSPDGSSFLTS
SDDQTIRLINGKTGQIDYLTEAQVSCCCLSPHLQYIAFGDENGAIETYFIDIQVWNWQLE
EYDVLQAHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGKVEKDFVCHQGTVLSCDISH
DATKFSSTSADKTAKIWSFDLLSPLHELRGHNGCVRCCAFSVDSTLLATGDDNGEIRIWN
VSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYLKWWNVVTGQSLQTFYT
NGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE
NT seq 3522 nt   +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaattgtttgcttcaacatagagaagttctggaaaaggacatc
aagacatcctacatcatggatcacatgattagtgatggatttttaacaatatcagaagag
gaaaaagtaagaaatgagcccactcaacagcaaagagcagctatgctaattaaaatgata
cttaaaaaagataatggttcctacatatcattctacaatgctctactacatgaaggatat
aaagatcttgctgcccttctccatgatggcattcctgttgtctcttcttccagtggtaaa
gattcagttagtggaataacttcatatgtaaggacagtcctatgtgaaggtggagtacca
cagaggccagttgtttttgtcgcaaggaagaaactggtgaatgcaattcagcagaagctc
tcgaaattgaatggtgaaccaggatgggtcaccatatatggaatggcaggttgtggaaag
tctgtattagctgcagaagctgttagagatcattccctcttaaaacgttgtttcccaggg
ggagtgcattgggtttcagttgggaaacaagacaaatctgggcttctgatgaaactgcag
aatctttgcacacgattggatcaggatgagagtttttcccagagacttccacttaatatt
gaagaggctaaagaccgtctccgcattctgatgcttcacaaacacccaagctctctgttg
atcttggatgatatttgggacccttgggtgttgaaagcttttgacaatcagtgtcagatt
cttcttacaaccagagacaagagtgtaaccgattcagtaatgggtcctaaatatgtagtc
cctgtggagagtagcttagggaaagaaaaaggacttgaaattttatccctttttgttaat
atgaagaaagcagatttgccagaacaagctcatagtattataaaagaatgtaaaggctct
ccccttgtagtatctttaattggtgcacttttacgtgattttcccaatcgctgggagtac
tacctcagacaacttcagaataaacagtttaagagaataaggaaatcttcatcttatgac
tatgaggctctagatgaagccatgtctataagtgttgaaatgctcagagaagacatcaaa
aattattacacagatctttccatccttccaaaggatgttaaggtgcctacaaaggtatta
tgcattctctgggacatggaaactgaagaagttgaagatatactgcaggaatttgtaaat
aagtctcttttattctgtgatcggaatggaaagtcatttcgttattatttacatgatctt
caagtagattttcttacagagaagaattgcagccagcttcaggatctacataagaagata
atcactcagtttcagagatattaccagctgccaagtcttttaccagatcaggaagactgt
atgtattggtacaactttctggcctaccacatggccagtgccaagatgcacaaggaactt
tgtgctttaatgttttccctggattggattaaagcaaaaacagaacttgtaggccctgct
catctgattcatgaatttgtggaatacagacatatactagatgaaaaggattgtgcagtc
agtgagaattttcaggagtttttatctttaaatggacaccttcttggacgacagccattt
cctaatattgtacagctgggtctctgtgagccagaaacttcagaagtttatcagcaagct
aagctgcaggccaagcaggaggtcgataatggaacgctttacctggaatggataaacaaa
aaaaccatcatgaatctttcccgcttagttgtccgcccacacacagatgctgtttaccat
gcttgcttttctgaggatggtcagagaatagcttcttgtggagccgataaaaccttacag
gtgttcaaagctgaaacgggagagaaactcctagaaatcaaggctcatgaagatgaagtg
ctttgttgtgcgttctctacagatgacagatttatagcaacctgctcagtggataaaaaa
gtgaagatttggaattctatgaccggggaactagtacataactatgatgagcactcagag
caagtcaattgttgccatttcaccaacagtagtcatcattttctcttagccactgggtca
agtgactgcgtcctcaaactctgggatttgaatcaaaaacaatgtcgaaataccctgttt
ggccatataaattcagtcaatcactgcagattttcaccagatgataagcttctggctagt
tgctcagccgatggaaccttaaagctttgggatacgacatcagcaaatgagaggaaaagc
attaatgtgaaacagttcttcctaaattcagaggaccctcaagaggatatggacgtgata
gtgaagtgttgttcatggtctgctgatggtgcaaggataatggtggcagcgaaaaataaa
atcttcctttttgacattcataccagtgacctattgggagaaatccacatgggccatcac
agcaccatccagtactgtgacttcttcccccaaaatcatttggcagtggtggctttgtcc
cagtactgtgtagagttgtggaatatagactcacgttcaaaggtggctgactgcagagga
catttaagttgggttcatggtgtgatgttttctcctgatggatcatcatttttgacatct
tcggatgaccagacaatcaggctaattaatgggaaaacaggtcagattgattatctgact
gaagctcaagttagctgctgttgcttaagtccacatcttcagtacattgcatttggagac
gaaaatggagccattgagacttatttcattgatattcaggtatggaattggcaactggag
gaatatgatgttctacaagcccatcaggaaacagtgaaagacttcagactcttgaaaaat
tcaagactgctttcttggtcatttgatggaacagtgaaggtatggaatattattactgga
aaagtagaaaaagactttgtctgtcaccagggtacagtactttcttgtgacatttctcat
gatgctaccaagttttcatctacctctgctgacaagactgcaaagatctggagttttgat
ctcctttctccacttcatgaattgaggggccataatggttgtgtgcgctgctgtgccttc
tctgtggacagtaccctgctggcaacgggagatgacaatggagaaatcaggatatggaat
gtctcaaatggtgagctgcttcatttgtgtgctccgctttcagaagaaggagctgctacc
catggaggctgggtgactgacctttgcttttctccagatggcaaaatgcttatctctgct
ggaggatatcttaagtggtggaacgttgtcactgggcaatccttacagaccttctacaca
aatggaaccaatcttaagaaaatacatgtgtcccctgacttcaaaacatatgtgactgtg
gataatcttggtattttatatattttacagactttagaataa

DBGET integrated database retrieval system