KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101048274
Entry
101048274         CDS       T04350                                 

Gene name
ACADM
Definition
(RefSeq) medium-chain specific acyl-CoA dehydrogenase, mitochondrial
  KO
K00249  acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00071  Fatty acid degradation
sbq00280  Valine, leucine and isoleucine degradation
sbq01100  Metabolic pathways
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
Module
sbq_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
sbq_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101048274 (ACADM)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101048274 (ACADM)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101048274 (ACADM)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     101048274 (ACADM)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 HpaB_N
Other DBs
NCBI-GeneID: 101048274
NCBI-ProteinID: XP_010348950
LinkDB
Position
Unknown
AA seq 413 aa
MAAGFVRCCRVLRSISRFHWRSQHTKSALQREPGLGFSFELTEQQKEFQATARKFAREEI
IPVAAEYDKTGEYPIPLIRRAWELGLMNTHIPENCGGLGLGTFDACLITEELAYGCTGVQ
TAIEANSLGEIPVIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKG
DEYIINGQKMWITNGGKANWYFLLARSDPDPKAPANRAFTGFIVEADTPGVQIGRKELNM
GQRCSDTRGIVFEDVKVPKENVLIGEGAGFKIAMGAFDRTRPAVKSKKHLLVFLSSVFVS
DTMLSLYHQAVSFMLAEMVMKVELARMSYQRAAWEVDSGRRNTYYASIAKAFAGDIANQL
ATDAVQIFGGNGFNTEYPVEKLMRDAKIYQIYEGTAQIQRVIIAREHIGKYKN
NT seq 1242 nt   +upstreamnt  +downstreamnt
atggcagcggggttcgtgcgatgctgcagggtcctgagaagtatttctcgttttcattgg
agatcacagcatacaaaatctgctctacaacgtgaaccaggattaggatttagttttgag
ctcacggaacagcagaaagaatttcaagctactgctcgtaaatttgccagagaggaaata
atcccagttgctgcagaatatgataaaactggtgaatatccaatccccctaattagaaga
gcctgggaacttggtttaatgaatacacacattccagagaattgtggaggtcttggactt
ggaacttttgatgcttgtttaattactgaagaattggcttatggatgtacaggggttcag
actgctattgaagcaaattctttgggggaaatacctgttattattgctggaaatgatcaa
caaaagaagaagtatttggggagaatgactgaggagccattgatgtgtgcttattgtgta
acagaacctggagcaggctctgatgtagctggtataaagaccaaagcagaaaagaaagga
gacgagtatattattaatggtcagaagatgtggataaccaatggaggaaaagctaattgg
tattttttactggcacgttctgatccggatcccaaggctcctgctaatagagcctttact
ggattcattgtggaagcagataccccaggagtgcagattgggagaaaggaattgaacatg
ggccagcgatgttcagatactagaggaattgtctttgaagatgtgaaagtgcctaaggaa
aatgttttaattggtgagggagctggtttcaaaattgcaatgggagcttttgatagaacc
agacctgcagtaaagtctaagaagcatcttttagttttcctttcctctgtctttgtatct
gatacaatgctttctctatatcaccaagcagtatcatttatgttggctgaaatggtaatg
aaagttgaactagccagaatgagttaccaaagagcagcttgggaggttgattctggtcgt
cgaaacacctattatgcttctattgcaaaggcatttgctggagatattgcaaatcagtta
gctactgatgctgtgcagatatttggaggcaatggatttaatacagaatatcctgtagaa
aaactaatgagggatgccaagatctatcagatttatgaaggtactgcacaaattcaaaga
gtcattatagcccgtgaacacattggcaagtataaaaattaa

DBGET integrated database retrieval system