KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101048514
Entry
101048514         CDS       T04350                                 

Gene name
GFAP
Definition
(RefSeq) glial fibrillary acidic protein isoform X1
  KO
K05640  glial fibrillary acidic protein
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101048514 (GFAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101048514 (GFAP)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sbq04812]
    101048514 (GFAP)
Membrane trafficking [BR:sbq04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    101048514 (GFAP)
Cytoskeleton proteins [BR:sbq04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     101048514 (GFAP)
SSDB
Motif
Pfam: Filament Filament_head Spc7 DUF1664 Topoisom_I_N GAS T6PP_N
Other DBs
NCBI-GeneID: 101048514
NCBI-ProteinID: XP_003943643
UniProt: A0A2K6SJQ5
LinkDB
Position
Unknown
AA seq 430 aa
MERRRITSARRSYASQGEMMVGGLASRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGF
KETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRE
LRLRLDQLTANSARLEVERDNLAQDLGTVRQKLQDETNLRLEAENNLAAYRQEADEATLA
RLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQY
EAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLRGT
NESLERQMREQEERHAREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALDIE
IATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIK
ESKQEHKDVM
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggagaggagacgcatcacctctgctcgccgctcctacgcctcccagggggagatgatg
gtggggggcctggcttcccgtcgtctgggtcctggcacccgcctctccctggctcgaatg
ccccctccactcccgactcgagtggacttctccctggccggggcactcaatgctggcttc
aaggagacccgggccagtgagcgggcagagatgatggagctcaatgaccgctttgccagc
tacatcgagaaggttcgcttcctggaacagcaaaacaaggcgctggctgctgagctgaac
cagctgcgagccaaggagcccaccaagctggccgacgtctaccaagctgagctgcgagag
ctgcggctgcggctcgatcaactcaccgccaacagcgcccggctggaggtcgagagggac
aatctggcacaggacctgggcactgtgaggcagaagctccaggatgaaaccaacctgagg
ctggaagcggagaacaacctggctgcctatagacaggaagcagatgaagccaccctggcc
cgtctggatctggagagaaagattgagtcgctggaggaggagatccggttcttgaggaag
atccatgaggaggaggttcgggaactccaggagcagctggcccgacagcaggtccacgtg
gagttggacgtggccaagccagaccttactgcagccctgaaagagatccgcacgcagtac
gaggcaatggcgtccagcaacatgcatgaagccgaggagtggtatcgctccaagtttgca
gacctgacggacgctgctgcccgcaacgcggagctgctccgccaggccaagcacgaggct
aacgactatcggcgccagctgcagtccttgacctgcgacctggagtctctgcgaggcacg
aacgagtccctggagaggcagatgcgcgagcaggaggagcgccacgcgcgggaggcggcc
agttaccaggaggcgctggcgcggctggaggaagaggggcagagcctcaaggacgagatg
gcccgccacttgcaggagtaccaggacctgctcaacgtcaagctggccctggacatcgag
atcgccacctacaggaagctgctggagggcgaggagaaccgcatcaccattcctgtgcag
accttctccaacctgcagatccgagaaaccagcctggacaccaagtctgtgtcagaaggc
cacctcaagaggaacatcgtggtgaagactgtggagatgcgggatggagaggtcattaag
gagtccaagcaggagcacaaggatgtgatgtga

DBGET integrated database retrieval system