KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101048662
Entry
101048662         CDS       T04350                                 

Gene name
FH
Definition
(RefSeq) fumarate hydratase, mitochondrial
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00020  Citrate cycle (TCA cycle)
sbq00620  Pyruvate metabolism
sbq01100  Metabolic pathways
sbq01200  Carbon metabolism
sbq04934  Cushing syndrome
sbq05200  Pathways in cancer
sbq05211  Renal cell carcinoma
Module
sbq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101048662 (FH)
   00620 Pyruvate metabolism
    101048662 (FH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101048662 (FH)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101048662 (FH)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101048662 (FH)
Enzymes [BR:sbq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     101048662 (FH)
SSDB
Motif
Pfam: Lyase_1 FumaraseC_C
Other DBs
NCBI-GeneID: 101048662
NCBI-ProteinID: XP_003935387
UniProt: A0A2K6UGJ6
LinkDB
Position
Unknown
AA seq 510 aa
MYRALRLLARSRRLARAPASASASASGLGGAAVPSFWPPNTARMASQNSFRIEYDTFGEL
KVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKLANAI
MKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKKPVHPNDH
VNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALEAKSKEFAQIIKIGRTHTQDAV
PLTLGQEFSGYVQQVKYAMSRIKTAMPRIYELAAGGTAVGTGLNTRIGFAEKVAAKVAAL
TGLPFVTAPNKFEALAAHDALVELSGATNTTACSLMKIANDIRFLGSGPRSGLGELILPE
NEPGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSA
RLLGDASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGS
TLKETAIELGYLTAEQFDEWVKPKDMLGPK
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgtaccgagcgctccggctcctcgcgcgctcgcgtcgcctcgcgcgggctcctgcctcc
gcctcagcttcggcttccggcttgggcggcgcggccgtgccctcgttttggcccccgaac
acggctcgaatggcaagccagaactccttccggatagaatatgatacgtttggtgagctg
aaagtgccgaatgataagtactatggggcccagaccgtgagatctaccatgaactttaag
attggaggtgtgacagaacgcatgccaaccccagttattaaagcttttggcatcttgaag
cgagcggctgctgaagtaaaccaggattatggtcttgatccaaagcttgccaatgcaata
atgaaggcagcagatgaggtagctgaaggtaaattaaatgatcattttcctctcgtggta
tggcagactggatcaggaactcagacaaatatgaatgtaaatgaagtcattagcaataga
gcaattgaaatgttaggaggtgaacttggcagcaagaaacctgtgcatcccaacgatcat
gttaataaaagccagagctcaaatgatacttttcccacagcaatgcacattgctgctgca
atagaagttcatgaagtactgttaccaggactacagaagctacacgatgctcttgaggcc
aaatccaaagagtttgcgcagatcatcaaaattggacgcactcatactcaggatgctgtt
ccacttactcttgggcaggaatttagtggttatgttcaacaagtgaaatatgcaatgtca
agaataaaaactgccatgccaaggatctatgagctcgcagctgggggcactgctgttggt
acaggtttaaatactagaatcggctttgcagaaaaggttgccgcgaaagtagctgcactt
acaggcttgccttttgtcactgctccaaataaatttgaagctctggctgctcatgacgct
ctggttgagctcagtggagccacaaacactactgcctgcagtctgatgaagatagcaaat
gatattcgttttctgggttctggtcctcggtcaggtctgggagaactaatcttgcctgaa
aatgaaccaggaagcagcatcatgccaggcaaggtgaaccctactcagtgtgaagcaatg
accatggttgcagcccaagtcatggggaatcacgtcgctgtaaccgttggaggcagcaat
ggacattttgagttgaatgttttcaaaccaatgatgattaaaaatgtgttacactcagcc
aggctgctaggggatgcttcagtttcctttacagaaaactgtgtggtaggaatccaggcc
aatacagaaaggatcaacaagctgatgaatgagtctctaatgttggtgacagctctcaat
cctcacatagggtatgacaaggcagcaaagattgctaagacagcacacaaaaatggatcc
accttaaaggaaactgctattgaacttggctatctcacagcagagcagtttgatgaatgg
gtaaaacctaaggacatgctgggtccaaagtga

DBGET integrated database retrieval system